KEGG   Prunus avium (sweet cherry): 110747661Help
Entry
110747661         CDS       T05161                                 

Definition
(RefSeq) hydroxymethylglutaryl-CoA synthase
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
pavi  Prunus avium (sweet cherry)
Pathway
pavi00072  Synthesis and degradation of ketone bodies
pavi00280  Valine, leucine and isoleucine degradation
pavi00650  Butanoate metabolism
pavi00900  Terpenoid backbone biosynthesis
pavi01100  Metabolic pathways
pavi01110  Biosynthesis of secondary metabolites
Module
pavi_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    110747661
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    110747661
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    110747661
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    110747661
Enzymes [BR:pavi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     110747661
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N ACP_syn_III_C Microtub_bd
Motif
Other DBs
NCBI-GeneID: 110747661
NCBI-ProteinID: XP_021803499
Position
Unknown
AA seq 469 aa AA seqDB search
MAKNVGILAADIYFPPTCIQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTV
VTSLLEKYGIDPKQIGRLEVGSETVIDKSKSIKTFLMTIFEKHGNTDIEGVDSTNACYGG
TAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIALLIGPDAPIAFESK
IRGSHMAHVYDFYKPDLASEYPVVDGKLSQTCYLKALDSCYKELCKKYEKLEGKQFSLAD
AEYFVFHSPYNKLVQKSFARLVFNDSERNASSIDEAAKEKLAPFASLPGDESYQSRDLEK
VSQQVAKPLYDAKVQPTTLVPKQVGNMYTASLYAAFVSLLHNKHSSLDGKRVILFSYGSG
STATMFSLRLNAGQHPFSLENIAAVLNVGEKLKSRHEFPPEKFVEVMKIMEHRYGGKDFV
TNQDISLLLPGTYYLTEVDSKYRRFYAKKEGGCTAAVTSNENGVVANGH
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaacgttggaattctcgccgccgacatctacttccctcctacctgtattcag
caggaagccttggaggctcacgatggtgcaagcaaaggaaagtacactatcggacttgga
caagattgcatggcgttttgttcagaggtggaagatgtcatctccatgagtttgacagtg
gttacctcccttcttgagaaatatgggattgatccaaaacaaattggtcggctggaagta
ggcagcgaaactgtcatagacaaaagcaaatctattaagaccttcctgatgacaattttt
gagaaacatggaaatactgacattgaaggtgtcgactcaactaatgcatgctatggggga
actgcagctttattcaactgtgtgaattgggtggagagtagctcgtgggatggacgctat
gggcttgtcgtgtgcactgacagtgcggtctatgccgaaggaccggcccgaccaactggt
ggagcagctgctattgctttgctgattggacctgatgctcctattgcttttgaaagcaaa
attaggggaagtcatatggctcatgtctatgatttttacaagcccgaccttgctagtgaa
tatccggttgttgatggaaaactttctcaaacatgttatctgaaggctctcgattcttgc
tacaaggaattgtgtaaaaagtatgagaaattggaaggcaaacaattttctctggctgat
gctgagtatttcgtatttcattctccttataacaagcttgtacaaaaaagctttgcccgt
ttggtattcaatgactccgagaggaatgccagctccattgatgaggccgctaaagaaaag
ctggccccatttgcgagcctacctggtgatgagagctaccaaagccgggatcttgaaaag
gtatcccagcaagttgcaaagcccctatatgatgctaaggtgcaaccaacaactttggta
ccaaagcaagttgggaacatgtacactgcatctctttatgcggcatttgtatcgctcctc
cataataagcacagctcattggatggcaagcgggtgatactcttctcttatggaagtggc
tcaactgctactatgttctcattgcgcctcaatgccggtcaacatccctttagcttggag
aacattgcagcagtgttgaatgttggagaaaagttgaagtcaagacatgagttcccgccc
gagaagtttgttgaagttatgaagatcatggagcacaggtatggtggcaaagactttgtg
acaaaccaggacattagccttctacttccaggcacatactatcttactgaagttgactct
aagtaccgtagattctatgccaagaaggaaggaggctgtactgccgccgtcacctccaat
gagaatggagtggttgccaacggtcactga

DBGET integrated database retrieval system