KEGG   Prunus avium (sweet cherry): 110748270Help
Entry
110748270         CDS       T05161                                 

Definition
(RefSeq) 8-amino-7-oxononanoate synthase-like
Organism
pavi  Prunus avium (sweet cherry)
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 110748270
NCBI-ProteinID: XP_021803961
Position
Unknown
AA seq 232 aa AA seqDB search
MRSWDHWVEEALQKLQHLQLVGSLRPIHLHSAPALKAQKPIEDDFNVFDELQPWDRSAVQ
VQITEATFQKWVHDIPSSGRVQFNHFSLSFKKLLLFSTNDYLGLGSHPTIGKAAAKVALE
HGMGPRSSALICGYTDYHRLLESCLADLKEKEDCLLCPTGFAANTSLMVALGSIGTLLAA
GKTPLPDEKIAIFSDALNHASIIDGIRIADKQKSVQIFVYRHCDMNHLDALL
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaggtcgtgggatcattgggttgaagaggctcttcagaaactccagcacctgcaactc
gttgggtctctcaggcccattcacctccatagtgcaccagctctaaaagcccaaaaacct
attgaagatgacttcaatgtgttcgatgaactgcaaccatgggatcgatccgctgtgcag
gttcaaattactgaagccacattccaaaaatgggtccatgacattcccagttcaggtagg
gttcagttcaaccatttctcacttagtttcaaaaagctgctactattttctacgaatgat
tatttgggcttgggttcacatcctactattggaaaagctgcagctaaggttgccctagaa
cacggaatgggcccaaggagttctgctttaatctgtggatatactgattaccataggtta
ctcgagtcatgcctggcagacttgaaggagaaagaggattgtcttctttgtccaacggga
tttgcagccaatacgtccttgatggtagctttgggatctattggcactctcttggctgct
ggcaaaacacctttacctgatgaaaagattgccattttttctgatgcactgaaccatgcg
tcaataattgatggtattcgtattgctgacaagcaaaagtctgtacagatattcgtctat
agacattgtgacatgaatcaccttgatgccttgttgtaa

DBGET integrated database retrieval system