KEGG   Prunus avium (sweet cherry): 110748855Help
Entry
110748855         CDS       T05161                                 

Definition
(RefSeq) probable L-type lectin-domain containing receptor kinase S.5
Organism
pavi  Prunus avium (sweet cherry)
Brite
Enzymes [BR:pavi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110748855
Protein kinases [BR:pavi01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110748855
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_legB Pkinase Pkinase_Tyr Bact_lectin Haspin_kinase Kinase-like SKG6 Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 110748855
NCBI-ProteinID: XP_021804519
Position
Unknown
AA seq 721 aa AA seqDB search
MKLKQLAIITSGMVLLLLLLFPAAAFSDAQNLEPFQYKWGPFNQSDYKTFEVINSSTISN
DALQITPDSTGNFKLTNRSGRVLFNQPFPLWTDSDSPGSATTGASVRVASFNTSFLVNLN
RVNGNPVPGEGLAFLIAPNLTLPQGSDGQYLGLTNAASDGNPSNHLLAVELDTFKQSFDP
DDNHLGLNINSIQSNKTVSLSDLDIQIAPNTTKYYMVWVQYDGVSRQLDVFMAEQLGDPR
TSPFFIMPRPTRSILTANLNLKDIVQQKSYFGFSASTGSATQLNCLLRWNLTVEKLPGFG
REDGKSQGLKIGLGVGVPVVVLLLLGLVGLVYYVHKGRRAAASDPNILGALKSLPGTPRE
FEFKELKKATNNFDEKHKLGQGGFGVVYRGVLPKENLEVAVKKFSRDNLKGKDDFLAELT
IINRLRHKHLVRLLGWCHKTGMLLIVYEYMPNGSLDNHLFGGPENATLGWSQRFKIVSGV
ASALHYLHNDYDQRVIHRDLKASNIMLDSHFNSRLGDFGLARALENEKTSYAELEGVPGT
MGYIAPECFHTGKATCESDVYGFGAVLLEVACGQRPWTKMGGFQFVVDWVWSLHREGRVL
EAVDERLGSDYVAEEAERLLLLGLACSHPIANERPKTQAIIQIISGSVPVPRVPPFKPAF
VWPSSSMPEGVSSVANTLNTTSTSSWPLGISVSDRSEWTPRYDSQDSYGGAGGYSESSSL
V
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgaagcagctggctataatcacttccggcatggtgcttctgctgcttctgctt
ttccccgcagcagctttctccgacgctcagaacctcgaaccatttcagtacaagtggggc
cccttcaaccaatcggattacaagacgtttgaggtgatcaattcgtcgacgatcagcaac
gacgctctccagatcacgccggactccaccggcaacttcaagctcacgaaccgctcaggt
agagtccttttcaaccagcctttcccgctctggaccgattcggattctcctggctccgcc
acaaccggagcctcggtacgcgtggcgtctttcaatacgtcgttcctcgttaacctcaat
cgtgtcaacggcaaccccgtccccggagagggcctggccttcctcatcgcaccgaatctc
accctccctcaaggcagcgacggtcaatacctcggtttaaccaacgccgcctccgatggg
aaccccagcaaccacctcctcgccgtcgagctcgacacttttaagcaaagcttcgacccg
gacgacaaccatttgggcctcaacatcaactcgatccaatccaacaagaccgtttcacta
tcggatctggatatccagatcgccccaaacactaccaaatattacatggtctgggtccag
tacgacggcgtttcgcgtcagttagacgtgttcatggccgaacagttgggggacccaaga
acgagccctttcttcatcatgcccaggcccacaaggtcaatcttaacggctaatctcaat
ctcaaggacattgtgcagcagaaatcctacttcggtttctctgcatcgaccggcagtgca
acacagctcaattgcttgttgagatggaatctgacggtggagaagttgccaggtttcggg
cgtgaagatggcaaaagtcaggggctgaagataggacttggagtgggtgtgcccgtggtg
gtgctgctcctgttgggcttggtagggctggtatattacgtgcacaaggggcggagggcc
gccgcgtctgacccgaatatcttaggggcactcaagagccttccgggcactccaagggag
tttgagttcaaggagctgaagaaggctacgaacaacttcgacgagaagcacaagctaggg
caaggtgggtttggggtggtctatagaggtgtgctacccaaagagaatttggaagtggct
gtgaagaaattctcccgggataatctcaagggtaaagacgactttttggctgagctcacc
attatcaaccgcctccgccacaagcatctcgtccggctacttggatggtgccacaaaact
gggatgctactcatagtatacgagtacatgccgaacggaagcttggacaaccaccttttc
gggggtcctgagaatgcaacactaggctggagccagaggttcaaaattgtatccggagtg
gcgtctgccttgcattacctccacaacgactacgaccaaagagtgatccatagagacctc
aaggccagcaacataatgctagactcccacttcaactcccgcctcggcgactttggcctc
gcacgtgccttggaaaacgagaaaacctcgtatgcggagctcgagggtgtaccgggcaca
atggggtacatcgcacccgagtgcttccacacgggcaaggccacgtgcgagtctgatgtc
tatgggttcggggctgtgcttctagaagttgcctgcggtcaacgaccatggaccaaaatg
ggcgggtttcagtttgtggtggattgggtttggtccttgcatagagaagggcgtgtcttg
gaggccgtggacgagaggctggggagtgattacgtggcagaggaagctgagaggcttttg
cttcttgggctagcctgctctcaccctattgccaacgagaggcccaagacccaggccatt
atccaaatcatttccgggtcggttccggtgccccgagtcccaccttttaaacccgctttt
gtgtggccctcctcctctatgcctgaaggagtaagcagcgtagccaacactctgaatacg
acgtcgacgtcgtcatggcctcttgggatatcagtttcggatagatctgaatggacccca
cgctacgacagccaggacagctatggaggagcaggaggatatagtgagagctcctctctg
gtttaa

DBGET integrated database retrieval system