KEGG   Prunus avium (sweet cherry): 110749720Help
Entry
110749720         CDS       T05161                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
pavi  Prunus avium (sweet cherry)
Pathway
pavi00010  Glycolysis / Gluconeogenesis
pavi00562  Inositol phosphate metabolism
pavi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110749720
   00562 Inositol phosphate metabolism
    110749720
Enzymes [BR:pavi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     110749720
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     110749720
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 110749720
NCBI-ProteinID: XP_021805576
Position
Unknown
AA seq 495 aa AA seqDB search
MKRAVAAVLLVLLSLLVHSNAEEEAFDVRQHLSTVCRYGVVKGIADSSFVPSKIPNGCTP
IHLNLVARHGTRSPTKKRIKELDNFATHLEVLLREAEEQNLSLEKLPGWLKGWKSPWKGK
LKGGELIIQGEDELYDLGIRTRARFPNLFNDDYHPDVYAIKATQVPRASASAVAFGMGLF
SGKGRLGPGRHRAFAVTSESRASDTKLRFHDCCQNYKAFKKSQEPAVDKLKEPVYDEITS
GLRRRYRLNFTRQDTTSLWFLCKQEASLLNIVDQACALFSPSEVSLLEWTDDLEAFILKG
YGKSINYRMGVPLLEDVVQSMEQAIKAEEEKHAPGSYEKARLRFAHAETVIPFSCLLGLF
LDGSEFEKIQREQALPHPPKPPQKRNWRGHTVAPFGGNNMLVLYSCPANTSNKHFVQVLH
NENPIPMPGCDGTDFCPLDVFKERIVAPHLKHDYNSVCNVKLEQQEQKPVASKLSQLFRW
MFSLGNGDKSSLDEL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtgccgtggcggctgttctgctagtattattatcgctactcgttcattcaaat
gccgaagaagaagcattcgatgttcgccaacacctttctactgtttgcagatacggtgtc
gttaaaggcattgcggacagttcatttgttccatcgaagattccaaatggatgtactcct
atccacttaaatcttgtggcaaggcatggaactcgttctcctaccaaaaagcggattaaa
gagttggacaacttcgcaactcatctggaggtgttactgagagaagctgaagaacagaac
ctgtctttggaaaaacttcctggttggttaaagggttggaaatctccttggaaaggaaaa
ctgaaaggtggagaattaattatccaaggagaggatgaactctatgatcttgggatcagg
actcgagcaagatttccaaatttgtttaatgatgattaccatccagatgtttatgcaata
aaggcaacacaggtccctcgggcatcagccagtgctgtggcatttggcatgggattgttt
agtgggaaaggaagacttggaccagggcgtcatcgagcttttgctgtaaccagtgaaagc
cgtgcaagtgatacaaagctaaggtttcatgattgttgccaaaactacaaggcatttaag
aaaagtcaggagcctgctgttgataagcttaaggaacccgtttatgatgaaataacttct
ggattaagaaggcgctacaggttgaattttacaaggcaggatacaacttctctttggttt
ctgtgcaaacaggaagcgtccttgttgaatatagttgatcaagcttgtgcacttttcagc
ccttctgaggtttctttgctggaatggacagatgatttggaggcctttatattaaaggga
tatggtaaatcaataaactatagaatgggtgtgcccttacttgaagatgttgtgcagtcc
atggagcaggctattaaggctgaagaagaaaaacatgctcctggtagttatgagaaggcg
agactaaggttcgcacatgcagaaactgtcattccattttcatgcctacttggacttttt
cttgacggatctgaatttgaaaaaatacagagggaacaggccttgccacaccctccaaag
cctccccagaagagaaattggaggggccatacagtggcaccttttggtgggaataacatg
ctggttctgtacagttgtccagccaacacatcaaacaagcactttgtgcaagtgctgcac
aatgaaaatcccattccaatgccaggttgtgatggtactgatttctgtccacttgatgtt
tttaaggaaagaattgttgcccctcatttgaagcatgactataattctgtgtgcaatgta
aaactagaacaacaggagcagaagcctgttgctagtaagttatctcaactgttccgttgg
atgttctcactggggaatggtgataaaagttccctcgatgaattgtag

DBGET integrated database retrieval system