KEGG   Prunus avium (sweet cherry): 110749976Help
Entry
110749976         CDS       T05161                                 

Definition
(RefSeq) alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
  KO
K00736  alpha-1,6-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.143]
Organism
pavi  Prunus avium (sweet cherry)
Pathway
pavi00510  N-Glycan biosynthesis
pavi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    110749976
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pavi01003]
    110749976
Enzymes [BR:pavi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.143  alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     110749976
Glycosyltransferases [BR:pavi01003]
 Glycan extension
  N-Glycan
   110749976
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MGAT2
Motif
Other DBs
NCBI-GeneID: 110749976
NCBI-ProteinID: XP_021805900
Position
Unknown
AA seq 422 aa AA seqDB search
MANIKKNRLKDEVAFRRFLPLVSITLLGVFLLMFLLRINSNFATPFSDDFSQVLTNRSHA
RQMLSLPKQTEFSLQLEKRNQMPPRNLDLYPSLDEDHITIVLYVHNRPQYLKVAVDSLSR
VVGINETLLIVSHDGYFEEMNKIVEGIRFCQVKQIFAPYSPHVFPNSFPGVSPTDCKEKD
DATKKHCKGTPDQYGNHRSPKIVSLKHHWWWMMNTVWDGLKETKDHSGHILFIEEDHYIY
PNAYRNLQILTELKPQKCPHCYAANLAPCDVNARGEGWDSLIAERMGNVGYTFNRTVWRK
IHKKTTEFCFFDDYNWDITMWATVYPSFGNPVFTLRGPRTSAVHFGKCGLHQGQGEAKAC
IDNGMVNFQVEEIDTVANINSDWEVRVFEHQPGYKAGFKGWGGWGDKRDHQLCLTFAQMY
HS
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggctaatattaagaaaaaccgtctaaaagatgaagtggcttttcgccgtttcttgcca
ttggtttcgattacattgttaggggttttcctgctgatgttccttctgagaattaattca
aattttgccacaccattttcggatgattttagtcaggtattgacaaatcgttcacatgct
agacaaatgcttagcctccccaagcagactgaattctcacttcagttggaaaagagaaat
cagatgcctcccaggaacttagatctatatccaagtctagacgaggatcacataactatt
gttctttatgtacacaatcggccccaatatctcaaagtagctgttgatagtctgtctcgg
gttgtaggaattaatgaaactttactaatagtgagccatgacggatactttgaagaaatg
aacaagattgtggaaggcatcagattttgccaggtgaaacagatattcgctccttactcg
ccccacgtctttcccaatagctttccaggtgtttcaccaacagactgtaaggagaaggat
gatgcaacaaagaaacactgcaaagggactcctgatcaatatggaaaccaccggtccccg
aagatagtgtcattaaaacatcattggtggtggatgatgaacacggtgtgggacggattg
aaggagaccaaggatcacagtggtcatattcttttcatagaggaggaccactatatttat
cccaatgcgtatcgtaacttacagatactcacagaattgaagcctcagaaatgccctcat
tgctatgctgcaaatttagcaccttgtgatgtgaatgcaagaggagaaggttgggatagt
ttgatcgccgagagaatggggaatgtgggttatacatttaaccggactgtgtggaggaaa
atccacaaaaagactacagagttctgtttctttgacgattataattgggatataacaatg
tgggcaacagtctatccctcatttggtaatcctgttttcacgctacgaggtcctcgaaca
agtgcagtacactttggaaaatgtggtttgcaccagggccagggggaggcgaaagcatgc
atcgataacggtatggtaaactttcaagtggaggagatagatacggttgcaaacatcaac
tcagactgggaagtgcgagtctttgagcatcagccagggtataaagctgggttcaagggt
tggggaggttggggagacaagagagaccaccaattgtgcttgacttttgctcagatgtat
cattcatag

DBGET integrated database retrieval system