KEGG   Prunus avium (sweet cherry): 110750085Help
Entry
110750085         CDS       T05161                                 

Definition
(RefSeq) probable glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pavi  Prunus avium (sweet cherry)
Pathway
pavi00480  Glutathione metabolism
pavi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    110750085
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pavi02000]
    110750085
Enzymes [BR:pavi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     110750085
Transporters [BR:pavi02000]
 Other transporters
  Pores ion channels [TC:1]
   110750085
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2 GST_C_5 GST_C_6 Stimulus_sens_1
Motif
Other DBs
NCBI-GeneID: 110750085
NCBI-ProteinID: XP_021806047
Position
Unknown
AA seq 222 aa AA seqDB search
MEEVKVLGFWTSPYPHRVIWALKLKGVKYEYIEEDIYNKSDLLLQSNPVHKKVPVFFHGG
KIIAESTVILEYIEETWPQNPLLPNDPYARAMARFWTKFLDDKKPNVLGFFRKIGDEQAK
AVKDAQEIMTILEQHSLGENKFFNGDEIGMTDLAFGLITFWLEVMEEAAGVQVLEVNRFP
RLQAWIKNFKEVPVIKENHPDESRLLAYMKERREEHVKKATS
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagtaaaggtactagggttctggacaagtccatatcctcacagggttatatgg
gctctgaaactcaagggtgtcaaatatgaatatatagaagaagacatatacaataagagt
gatttgcttcttcagagtaacccagtgcataagaaggttccagtgttttttcatggtgga
aaaataattgccgagtccactgttattcttgagtacattgaagagacgtggcctcagaac
cctctgctaccaaacgacccttatgcaagggccatggctcggttttggactaagttctta
gatgacaagaagccaaacgttcttgggttctttaggaaaattggagatgagcaagcaaaa
gcagtaaaagacgcccaagaaattatgacaatcttggaacagcatagccttggggagaac
aagtttttcaacggtgacgagattggaatgacagacttagccttcggattgataacattc
tggcttgaggtcatggaagaagcagctggtgtacaagtgctggaagtcaatcgcttccct
cgcttgcaggcatggattaaaaatttcaaggaagttcctgtgattaaagaaaatcatccc
gatgagagccgcctgttagcctatatgaaagaacgaagggaggagcatgtcaagaaagca
acttcttga

DBGET integrated database retrieval system