KEGG   Prunus avium (sweet cherry): 110751532Help
Entry
110751532         CDS       T05161                                 

Definition
(RefSeq) autophagy-related protein 16
  KO
K17890  autophagy-related protein 16-1
Organism
pavi  Prunus avium (sweet cherry)
Pathway
pavi04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    110751532
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pavi04131]
    110751532
   03029 Mitochondrial biogenesis [BR:pavi03029]
    110751532
Membrane trafficking [BR:pavi04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    110751532
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    110751532
Mitochondrial biogenesis [BR:pavi03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    110751532
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 ATG16 Nup160 eIF2A Cytochrom_D1 Nucleoporin_N DUF948 Fzo_mitofusin Fib_alpha V_ATPase_I
Motif
Other DBs
NCBI-GeneID: 110751532
NCBI-ProteinID: XP_021807700
Position
Unknown
AA seq 508 aa AA seqDB search
MSQEEIAREAIKHALKALRKRHLLEEGAHAPAFIALARPIAHQGSEWKEKAESLELELQQ
CYKAQSRLSEQLVVEVAESRASKASLQEKEAAVADLQKELTEKRDECSQLTTDLEEKIKA
LDLVVSENKEIRAQLEEMSIRAKNAEAESKVLIDRWMLEKMKDAERLNEANALYEDMIER
LRASGLEKLARQQVDGVVRQSEEGAEYFVESTIPSACKSRIHAHEGGCASILFEYNSGKL
ITGGQDGSIKMWDTNTGALNHTLHGCIGSVLDITITHDNRSIIAASSSNKLYAWDVSSGR
VRHTLTGHMDKVCAVDVSNSSRHVVSAAYDRTIKVWDLQKGYCTNTIIFPKNCNALCFSM
DGQTICSGHVDGNLRLWDIEKGKLLSEVAAHSNAVTSISLSRNGNVVLTSGRDNVHNLFD
MRSLEVCGTLRATGNRVASNWSRSCISPDDNYVAAGSADGSVYIWSISKADIVSTLKEHT
ASVLCCSWSGHGKPLASADKNGIVCTWA
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaggaggagatagcaagggaagcgataaagcacgcactgaaggctcttcggaag
cggcatttgctcgaagaaggtgctcatgctccggcttttatcgctcttgcgaggccaatt
gctcatcagggctcagaatggaaggagaaagcagagagtttggaactcgaacttcagcaa
tgttacaaagctcaatctcgattgtccgagcaacttgtggtggaagtagcagagtccaga
gcttcaaaagcttcacttcaagagaaagaagcagcagtggctgatctccaaaaggagtta
acagaaaaaagggatgaatgctctcaattaacgactgacttagaagagaagattaaagcc
ttagacttggttgtgagtgagaacaaggaaataagagcgcagcttgaagaaatgtctatt
agagctaagaatgctgaggctgaaagtaaggtgttaattgaccgctggatgttggaaaag
atgaaggatgctgaacgccttaacgaggcaaatgcactctatgaagatatgattgagcgg
ctcagggccagtggtctggaaaaacttgctaggcagcaagtagatggtgtggtccgccaa
agtgaagaaggtgctgagtactttgtggagtcaacaattccctctgcatgcaagagcagg
atccatgcccatgaaggtggttgtgcttccatattatttgagtacaattctggcaaattg
attactggcggacaggacgggtccatcaaaatgtgggatacaaatactggggcactaaat
catacacttcatggttgcattggttccgttcttgatattaccattacccatgataataga
tctatcattgcagcaagcagctcaaacaaattgtatgcctgggatgttagctcggggagg
gttcgccatactctcactggccacatggataaagtatgtgctgtagatgttagcaattcg
agtcgtcatgttgtgagcgcagcctatgatcgtaccataaaagtttgggatttgcagaaa
ggttactgcaccaacacaattattttccccaaaaactgcaatgctctttgcttcagcatg
gatggacagaccatatgttctgggcacgtcgatggaaaccttcgcttgtgggatattgag
aaaggaaagctactcagtgaagtagctgcacattcaaatgctgttacatccatatctttg
tcccgaaatggcaacgttgtattgacaagtggaagagacaacgtgcataatttgtttgat
atgcggtctctggaagtctgcggcacattaagggccaccggaaacagagtggcgtctaac
tggagccggtcctgtatcagtccagacgacaattatgttgccgctggatctgccgatggt
tctgtgtatatttggtcaatctctaaggccgacattgtgagcactctgaaggaacacact
gcatctgtgctgtgttgttcatggagtgggcatggaaaacctctagcttctgcggacaag
aacggcattgtttgcacttgggcgtga

DBGET integrated database retrieval system