KEGG   Prunus avium (sweet cherry): 110752294Help
Entry
110752294         CDS       T05161                                 

Definition
(RefSeq) 8-amino-7-oxononanoate synthase-like
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
pavi  Prunus avium (sweet cherry)
Pathway
pavi00780  Biotin metabolism
pavi01100  Metabolic pathways
Module
pavi_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    110752294
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pavi01007]
    110752294
Enzymes [BR:pavi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     110752294
Amino acid related enzymes [BR:pavi01007]
 Aminotransferase (transaminase)
  Class II
   110752294
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 110752294
NCBI-ProteinID: XP_021808601
Position
Unknown
AA seq 214 aa AA seqDB search
MTGVLSDDAITKFADCLLWPTGFAANMALMVALGNVGSLLAAGKTPLTNEKIAIFSDALN
QALITNGILLAERQKSVEIFIYRHYDMTHLNVLLSSCTMRKKVVMTDSLFSMDGDFAPMI
ELVKLSKAHGFLLVIDDAHGTFVCGKNGGGVAEQYNCERDVDICVGTLSKAAGCHGGFIA
CSKRWKQLIQSRGRSFIFSTATPIPISAAARGNI
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgacgggtgtcctaagcgacgatgccataaccaaatttgctgattgccttctttggccc
acaggatttgcagccaatatggcgttgatggtagctttgggaaatgttggctctctcttg
gctgctggaaaaacacctttaactaatgaaaaaattgcaattttttctgatgcactaaac
caagcgttaataaccaatggtattcttcttgccgaacgacaaaaatctgtagagatattc
atctatagacattatgacatgactcaccttaatgtattgttatcaagttgcacaatgagg
aagaaagtcgtcatgactgatagcttgtttagtatggacggagactttgcaccaatgatt
gagcttgtgaagctaagcaaagcgcatggctttctgttagttattgatgatgctcatgga
acatttgtttgtggcaaaaatggtgggggagtggcagagcaatacaattgtgaaagagat
gttgacatatgtgttgggactttgagtaaggctgcaggttgccatggcggattcatagca
tgcagcaaaaggtggaagcaactcatacaatcaaggggtcggtcttttatattttcaact
gctacgccaataccaatttctgctgctgcccgtggtaatatataa

DBGET integrated database retrieval system