KEGG   Prunus avium (sweet cherry): 110752341Help
Entry
110752341         CDS       T05161                                 

Definition
(RefSeq) probable receptor-like protein kinase At5g24010 isoform X1
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
pavi  Prunus avium (sweet cherry)
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pavi01001]
    110752341
Enzymes [BR:pavi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110752341
Protein kinases [BR:pavi01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110752341
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Malectin_like Malectin APH Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 110752341
NCBI-ProteinID: XP_021808663
Position
Unknown
AA seq 838 aa AA seqDB search
MESLHNHKIHIPLFSLLFFLFHFSSLHFLSLAYEQPDKYFVNCGSKADANLNDRVFTADS
GFLCSEKGRTIKSTNQSTILYQTARIFYNQSNYEFMIAENGTYVVRLHFLAFSSPSVNLS
SALFNVSAFPIVSNSGFKLLNNFTAKDSGNSALIEEFFLAIGPGSLKLYFTPQGSSFAFV
NAIEVFRAPLKFSPRNYSSSFPLVLRTTYRVNVGGPKITPDNDTIWRNWEKDDSQPSAEN
SQPSSQPLNRLSVESDGFVGADNDSIAPDLVYLTAKLMTGGSNGLPNPFNITWSFNVSAD
ARHLVRVHFCDIIGPPANIVFNLYSNGNLITKVGGPNFPFNRLNQPFYYDFVLTSKESEF
INISIGPSIDTTTNNAFLNGLEMLEIIEGPALSNPPTSFCNMKGRKKIKVGLVVGSVIGG
LSLICIMIVGTLFGLKYRKAKRVETSEWSPMPAIGGGSAHGRLTDGTITGSPMNYLNLGL
KISFAELQQATNNFDTKLLIGEGGFGNVYRGTLLNGTNVAVKRGKRDEQGSGQGRPEFQT
EIMVLSKIRHRHLVSLIGYCDERSEMILVYEFMEKGSLRDHLYDSNLPRLSWKQRLEICI
GAARGLHYLHRGAAGGIIHRDVKSTNILLDENHVAKVADFGLSRSGPLDETHVSTNVKGT
FGYLDPEYIMSQQLTEKSDVYSFGVVLLEVLCARRAIDTMLPRDQMNLAEWGMLCKKKGL
LEQIVDTSIKNEIDPSSLRKFSETAEKCLQEDANDRPTMGDVLWDLEYAFQLQQTAKHRE
PHEDSTANASSAFALPNVQHFPSVSSTVNIDDLALPGDDELDTTEVEVFSQLRVGDAR
NT seq 2517 nt NT seq  +upstreamnt  +downstreamnt
atggaaagccttcataaccataaaatccatatccctctattttctctgcttttttttctc
ttccacttctcatctcttcactttctctctttagcctatgagcaacctgataagtatttc
gtcaattgtgggtctaaagctgatgcaaacctcaatgaccgggtgttcactgcagactct
ggttttttgtgctcagagaaaggcaggaccattaaaagcaccaaccagtcgacaattctg
taccaaacagcaagaattttctacaaccaatccaactatgagttcatgatcgctgaaaac
ggtacttatgttgtccgtctgcatttcttggctttctcctccccctcagttaatctctca
tcagctctttttaatgtttcggcttttcctattgtttcaaattctgggttcaaactgttg
aacaatttcactgccaaggacagtggcaactctgctttgatagaggaattctttcttgcc
attggtcctggctcattgaaattatattttacacctcaaggatcatcttttgcatttgta
aatgccattgaagtcttccgtgcacctttgaaattcagccctcggaattacagcagtagt
ttccctttagttctacgtacaacttacagggtgaatgttggaggcccgaaaatcacacca
gataatgacacaatatggagaaactgggaaaaagatgatagccaaccctctgcagagaat
agccaaccctcctcacagccgcttaatagactgtcggtagaatctgatggtttcgttggt
gctgataatgattctattgctccagatttagtttacctgactgccaaattgatgaccggt
gggagtaacgggctacccaatcccttcaacataacctggtcttttaatgtgagtgcggat
gctagacacctcgtccgggttcacttctgtgacattatcggtccgcctgctaatatagta
tttaacttgtattcaaatggaaacttaattacgaaggttggtggacccaatttccctttt
aatcgcctgaaccagcctttctattatgattttgtattgacttctaaagaatctgaattc
attaacatcagcataggccctagcatagacacaacaactaacaatgcctttctaaatgga
ctggaaatgttggagataatagagggaccagctttaagtaaccctccaacttcattttgt
aatatgaaagggcgcaagaagataaaggtgggtcttgtggttggttcagttattggaggc
ctgtcacttatctgcattatgattgtcggaaccttgttcggtttgaaatacagaaaggca
aagcgtgttgaaacttcggaatggtcaccaatgcctgcaattggaggagggagtgcccac
ggcaggttgactgatggaactattactggttcccctatgaattatctaaatcttgggttg
aagatatcttttgctgaacttcagcaagcaacaaacaactttgacacaaaattgttgata
ggtgagggtggctttgggaatgtctacagaggaactctgttgaatggcaccaatgtagct
gtcaagcgaggtaaacgagatgagcaagggtcaggccagggccgtccagaatttcaaaca
gagatcatggttttgtccaagattcgccaccgccatcttgtttccttaattgggtactgt
gatgaaaggtctgagatgatactggtctacgagttcatggaaaaagggagcttgagagat
catttatatgattcaaacttgcctcgcttgtcatggaagcaaaggcttgaaatttgcatt
ggtgcagcaaggggtcttcattacctccacagaggtgcagctgggggaatcattcaccgt
gatgttaagtccaccaacatcttgttggatgaaaaccatgttgccaaagttgctgacttt
ggcctttcaagatctggtcctcttgatgaaacacatgtcagcacaaatgttaaaggcact
tttggttaccttgatcctgaatacataatgtcccaacagttgacagaaaaatctgatgtt
tactcattcggcgtggttctccttgaggtgttatgtgcaagacgtgctattgatacaatg
ctcccaagagaccaaatgaatttagctgaatggggaatgctttgcaagaagaaagggttg
cttgaacagattgttgacacttcaatcaagaatgagattgatcctagctcattaagaaaa
tttagtgagacagcagagaaatgcttgcaagaagatgctaatgaccggcctacaatgggt
gatgtgctgtgggacttggagtatgcattccagctccagcaaacagcaaagcatagagaa
ccccatgaagacagcacagccaatgcttcatcagcatttgctttgccaaatgttcagcat
tttccttcagttagctccacggttaacatagatgatctggctcttcccggagacgatgaa
ttagatacgacagaagttgaagttttctcccaattgagagttggtgatgcccgataa

DBGET integrated database retrieval system