KEGG   Prunus avium (sweet cherry): 110752699Help
Entry
110752699         CDS       T05161                                 

Definition
(RefSeq) non-specific phospholipase C3-like
Organism
pavi  Prunus avium (sweet cherry)
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphoesterase
Motif
Other DBs
NCBI-GeneID: 110752699
NCBI-ProteinID: XP_021809104
Position
Unknown
AA seq 517 aa AA seqDB search
MASEPSSSSSSSSPIKTVVVLVQENRSFDHMLGWMKSLNPEINGVTGSESNLISTSDSNS
TQVFFGDSAAYVDPDPGHSIQAIYEQVFGEPWTEASASKKLPPKMNGFAQNAEKTQSGLA
ETVMSGFKPENVPVSAELVREFAVCDRWFASIPASTQPNRQFVHSATSHGLTSNDTQKLV
EGLPQKTIFQSLDEEDLSFGIYFQSFPSTLLYRSLRKLKYIKNFHAFDLQFKKHCEEGKL
PNYVVVGQRFFDVLSFPANDDHPSHDVSEGQKFIKEVYEALRASPQWNEMLFVITYDEHG
GFYDHVPTPVTDVPSPDDIVGPEPYNFKFDRLGVRVPTILISPWIERGIVLHGPSGPYPS
SEFEHSSIPATVKKIFNLKEFLTKRDAWVGTFEGVLSRTSPRTDCPVTLGEPVKLRETAS
REGAKLSDFQEELVQLAAALNGDHRKDIYPTKLVENISVAEALKYVEAAFEKFSDACEKA
RESGADESVIVVCETSPSPTYHKSFAQRIFSCLVCDN
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggcttcagagccaagcagcagcagcagcagcagcagtcccatcaaaacggtggtcgtt
ttggtgcaagagaaccgctccttcgaccacatgctggggtggatgaagtccctaaaccca
gagattaacggcgtcaccggatccgaatccaacctcatttccacctccgactcgaactcc
acccaagtcttcttcggcgacagcgccgcctacgtcgacccagacccgggccactccatc
caagccatctacgagcaagtgttcggcgagccgtggacggaggcctccgcttccaaaaag
ctacctccgaaaatgaacggttttgcccaaaacgctgaaaagacacagagtggtcttgct
gagacggtgatgagtggttttaagccggaaaacgtccccgtttcagcggagctggtgagg
gagtttgcggtttgtgaccggtggttcgcttcgattcctgcttcgacgcagccgaaccgg
cagttcgtgcactcggcgacatctcatgggctgacgagcaacgacacgcagaagctggtc
gaagggttgcctcagaagacaatatttcagtcgttggatgaagaagacttatcttttggg
atttactttcagtcctttccttccacccttctctacaggagcctaagaaaattgaagtac
atcaagaatttccatgcatttgatctgcaattcaagaaacattgcgaggagggaaagtta
ccaaactatgtggttgtggggcaaaggttctttgatgtcttatcatttcctgcgaatgat
gatcacccatcccacgacgtctccgaaggccagaagtttataaaagaagtgtatgaagca
ctaagagcaagcccccaatggaatgaaatgctgtttgtaataacatacgacgagcatggc
ggtttctatgatcatgttccaacacctgtgacggatgttcctagtccggatgatatcgtt
ggtcccgagccatacaactttaaatttgatcgtcttggtgttcgggttccaaccatctta
atatctccgtggatcgaacgtggaatagtgttgcatgggccttcagggccgtatccctcg
tcagaattcgagcactcctcaatcccagcaacagttaagaagattttcaatctcaaagag
ttcttgacaaagcgtgatgcttgggtgggaacctttgagggtgtcctgagcagaactagc
ccaagaacggattgtccagtcactttgggtgaacctgtgaaactacgagagactgcatct
agagagggggccaaattaagtgattttcaagaagaactagtgcaattggcagcggctttg
aacggggaccatagaaaggatatatatccaaccaaattggtggagaacatatctgttgca
gaagctctcaaatatgtggaagcagcatttgagaaattttcggatgcatgtgagaaagcc
agggaaagtggggcagatgaatctgtgattgtcgtctgtgaaacctccccttcaccaaca
tatcacaagtcttttgctcaaaggatattttcttgtttggtttgtgataactga

DBGET integrated database retrieval system