KEGG   Prunus avium (sweet cherry): 110753540
Entry
110753540         CDS       T05161                                 

Definition
(RefSeq) delta(14)-sterol reductase-like
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
pavi  Prunus avium (sweet cherry)
Pathway
pavi00100  Steroid biosynthesis
pavi01100  Metabolic pathways
pavi01110  Biosynthesis of secondary metabolites
Module
pavi_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    110753540
Enzymes [BR:pavi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     110753540
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 110753540
NCBI-ProteinID: XP_021810150
UniProt: A0A6P5RZE3
Position
Unknown
AA seq 369 aa
MDLGHVLHLLIPSWNSVAILALFFAYLAIAGSILPGKVVPGATLPDGSRLYYRCNGLLSL
LLLVGLLGFGAKMDFVSLTAISDRGFELLTTTFLFSVLVTLVLYAAGCKSSNRGSSLKPH
VTGNLLHDWWFGIQLNPQFMGIDLKFFFVRAGMMGWLFINLSVLSGSIQDGTLSQSMILF
QLFCALYILDYFFHEEYMTSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLSNKVELG
TAAVVANCLTFLIGYMVFRGANKQKHVIKKNPKAPIWGRPARVIGGKLLASGYWGIARHC
NYLGDLLLALSFSLPCGISSPVPYFYPIYLLILLVWRERRDEARCAEKYKEIWAEYRKLV
PWRILPYVY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggatctgggtcatgttctccacctcctaattccctcatggaactctgttgctatactc
gcattgttctttgcttacttggcaattgccggatctatattgcccggcaaagttgttccc
ggagccaccttaccagatggctctcgtctttattatcgctgcaatggtctgctatcactt
ctgttgctggttgggcttcttgggtttggtgctaagatggatttcgtatcacttactgca
atatcagacagaggatttgagctgttaacaacaacttttctgtttagtgttctggtcaca
ctggtactttacgctgctggctgcaagtcgagcaaccgaggttcttccctaaagcctcat
gtgacagggaaccttctacatgactggtggtttggaatacagcttaatcctcagtttatg
ggcatcgacctcaaatttttctttgttagagctggaatgatgggctggctatttatcaac
ctttcggttctttcgggaagtatccaagatggcaccttgagtcaatccatgatcctcttc
cagttgttctgtgcgttatacatcctggactacttttttcatgaggagtacatgacctcc
acatgggacataattgcagagagactgggtttcatgcttgtatttggagatctagtgtgg
attcctttcacttttagcatccagggatggtggcttctgagtaacaaggtggagttagga
acagctgctgttgtagcaaattgtttgacttttctgattgggtacatggtattcagagga
gccaacaagcaaaagcatgtcattaagaagaatcctaaagcacctatatggggtaggcct
gcaagggtcattgggggaaagttgcttgcttctggttattggggaattgcaaggcactgt
aattaccttggggacttgttacttgcactgtctttcagtttaccgtgtgggataagttcc
ccagttccatacttctatccaatttatcttctcattctgctcgtatggagagaaagaaga
gatgaagctcgttgtgcagagaagtacaaagaaatctgggcagaataccgcaaacttgtc
ccatggagaatattgccttatgtttattaa

DBGET integrated database retrieval system