KEGG   Prunus avium (sweet cherry): 110753635Help
Entry
110753635         CDS       T05161                                 

Definition
(RefSeq) probable protein S-acyltransferase 14
  KO
K20028  palmitoyltransferase ZDHHC2/15/20 [EC:2.3.1.225]
Organism
pavi  Prunus avium (sweet cherry)
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pavi04131]
    110753635
Enzymes [BR:pavi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     110753635
Membrane trafficking [BR:pavi04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    110753635
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 110753635
NCBI-ProteinID: XP_021810262
Position
Unknown
AA seq 301 aa AA seqDB search
MAWNAFKLCTALRALGYIMVLVVLAIVGLTYYAVVLANYLPAILGGGLSAVIAFPLLILF
HILLVMLLWSYFNVVLTDPGVVPPNWRPANDEEGGDRAPLVGSDQSTLVSDPANQKVRFC
RKCNHFKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTLS
LFKYFMAFFTEEEVIGTLGTVAASFITFVLNFAFALSVFGFMIMHLSLVASNTTTIEAYE
KKATPKWQYDLGRKKNFEQVFGTDKWYWFIPAYSEEDLRRIPALQGIDYPTRPELNALQP
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggaacgcgttcaagctctgtacggctctgcgtgcactcggctacatcatggtc
ctcgtggttctcgccatagtcgggctcacctactacgccgtcgttttggccaattatttg
cctgctatccttggcggaggcctcagtgccgtcattgccttccctctcttgatcttgttc
catattctgttggtgatgctgttgtggagctactttaatgttgttctaacggatcctggg
gttgttccaccgaattggaggcctgcaaacgatgaggagggaggtgacagagccccattg
gtgggatcggaccaatctaccctggtcagtgacccagcaaatcaaaaagtacggttctgt
cggaagtgcaaccactttaaaccacctcgatgtcatcattgttctgtttgtgggaggtgc
atattgaaaatggaccatcattgtgtgtgggtggtcaactgtgttggggcattgaattac
aagtacttccttctcttcttgttttacacatttcttgagacaactcttgtcactttatca
ttattcaagtattttatggcattttttactgaagaagaggtaattggaacactgggcact
gttgcagccagttttatcacatttgttttgaacttcgcatttgctttgagcgtttttggc
ttcatgatcatgcacctatcactggtagcgtccaataccaccactattgaggcatatgag
aagaaagccactcctaaatggcagtatgaccttggtcggaagaaaaactttgaacaggtg
tttgggacggataagtggtactggttcatccctgcatattcagaggaggatttaagacgg
ataccagctcttcagggtattgattatccaacaaggcctgagttgaatgcactccagccg
ttataa

DBGET integrated database retrieval system