KEGG   Prunus avium (sweet cherry): 110753745Help
Entry
110753745         CDS       T05161                                 

Definition
(RefSeq) putative amidase C869.01
  KO
K01426  amidase [EC:3.5.1.4]
Organism
pavi  Prunus avium (sweet cherry)
Pathway
pavi00330  Arginine and proline metabolism
pavi00360  Phenylalanine metabolism
pavi00380  Tryptophan metabolism
pavi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    110753745
   00360 Phenylalanine metabolism
    110753745
   00380 Tryptophan metabolism
    110753745
Enzymes [BR:pavi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     110753745
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 110753745
NCBI-ProteinID: XP_021810392
Position
Unknown
AA seq 501 aa AA seqDB search
MATGGGGDSPLMDKGQGFSIREATIDDIQLAFKLNQLTSKQLVQFYLGEITRLNPFLKGV
IEVNPDALDLAEKADYERKTKPPSVPLSKLHGIPILVKDNTATKDKLNTTAGSYALLGSV
VPRDAGVVTKLREAGAIILGKASLSEWSNWRSNSAPSGWSARGGQGVNPYNFEETPSGSS
SGSAISVAASLVAVALGTETDGSILSPCSYNSVVGIKPTVGLTSRAGVVPISPRQDTVGP
ICRTVSDAAYVLDVIAGSDNNDIATIETSKYIPEGGYAQFLKCDGLGGKRLGILRAFYDL
EDDPFLTQIFEQHLNTLRNGNAILVDHLEIANLIDIVIGSDERTALSAEFKISLNTYLKG
LVASPVRSLADVIAYNNKNSKVEKINEYGQDLLEESEKTNGIGPKELEVLSNLERLSRDG
FEKLMTDKSLDALVTYSSTASSILAIGGFPGIIVPAGFHDTKKYPFGICFGGLKGSEPKL
IEIAYAFEQATKIRKPPPVGS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggcaactggtggtggtggtgactctccgttgatggataaaggccaagggttctcaatc
agggaagccaccatagatgatatccaacttgctttcaagctcaaccagctcacctcaaag
caacttgtccaattttaccttggagaaatcaccagacttaaccctttcctcaagggggtc
atagaagtgaacccggatgcgcttgaccttgccgaaaaggcagactacgagcgcaagacc
aagccaccatctgtgccactctctaagttgcatggcattcccattctggtcaaggacaac
actgcaaccaaggacaagttgaacaccacagctggctcttatgctctgcttggctctgtt
gtgccccgggacgccggcgtggtgaccaagttgagggaggctggggccatcatactggga
aaggccagcttgagtgagtggtccaattggaggtccaatagtgcaccttctggttggagt
gccagaggtggccagggggtgaacccgtacaattttgaggagacgcctagcggctcaagc
agcgggtcagcaatatcagtggcagcaagtctggtagcagtggcactggggactgagaca
gatggatcaattttaagtccatgcagttataactcagtagttggcatcaaaccaacagtt
ggtcttactagtcgagcaggagttgtcccgatctccccgagacaggacacagttgggccc
atctgtaggacagtatcagatgctgcttatgttcttgatgtcattgcaggctccgacaac
aatgatattgcaacaattgagacatcgaagtacattcccgagggtggctatgcacaattt
ctcaaatgcgatggacttggaggaaagagattagggatattgagagccttctatgacttg
gaggatgaccctttcttgactcaaatttttgaacaacatctcaacacactgaggaatgga
aatgctattttggtagaccatttggaaatagccaatttgatcgatatcgttattggaagt
gatgaacggactgcattgtctgctgagttcaaaatatccttaaacacataccttaagggt
ttggtggcttccccagtgcgatccttggcagatgtgatagcctacaacaataaaaactcg
aaagtggaaaagatcaatgaatatggacaagatctcttagaagagtctgagaagactaat
ggaataggacctaaagagctggaagtgttgtcaaatttagaaagactgtctagagatgga
tttgagaagctaatgacagataagagcctagatgccttggtgacttattctagcactgct
tcttctatccttgcaattggtgggtttccgggcattattgtgccggcaggattccatgac
actaaaaagtacccttttggaatctgctttggggggctaaagggttcagagccaaagctg
attgagatcgcgtacgcatttgagcaagcaactaagatcaggaagcctccacctgttggt
tcttaa

DBGET integrated database retrieval system