KEGG   Prunus avium (sweet cherry): 110753913Help
Entry
110753913         CDS       T05161                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK4 isoform X1
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
pavi  Prunus avium (sweet cherry)
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pavi01001]
    110753913
   01009 Protein phosphatases and associated proteins [BR:pavi01009]
    110753913
Enzymes [BR:pavi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110753913
Protein kinases [BR:pavi01001]
 Serine/threonine kinases: Other
  Wnk family
   110753913
Protein phosphatases and associated proteins [BR:pavi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110753913
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 110753913
NCBI-ProteinID: XP_021810591
Position
Unknown
AA seq 585 aa AA seqDB search
MSKTDRAGYVETDPTARYGRFEEVLGKGAMKTVYKAIDELLGMEVAWNQVKLNEVLRSPE
DLQRLYSEVHLLSTLNHDSIIRFYTSWIDVDHKTFNFITEMFTSGTLREYRKKYKHVDIR
AIKNWARQILRGLVYLHGNDPPVIHRDLKCDNIFVNGHLGQVKIGDLGLAAILRGSQSAH
SVIGTPEFMAPELYDENYNELVDVYSFGMCVLEMLTSEYPYSECVNPAQIYKKVTSGKLP
GAFYRIQDLEAQRFIGKCLVNASKRLSAKELLLDPFLECGKNEPLPLGKLGRPKPFLNDK
EMEKLQLSDDQTRTDMTITGKLNPEDDTIFLKVQIADKDGSLRNIYFPFDILNDTPFDVA
TEMVKELEITDWEPFEIANMIEGEISALVPNWKTEAYHTINYQDDDDGPQRPHSHSSCSS
SHTSLSGLISSHGINGVTNGCDWLQDDFLDETSSQSSSHSGTYSNLNFICGNEHGTNTIP
TGGDKHPISKCHKSTRFCPEENRNTGHSMAKKYYERCKAFLASGSKDKRIVDSRRLMRNK
SLVDVRSHLLHRSLVEEVNRRRLFKTVGAVENIGFQAPCEVSKKL
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagactgacagggctggttatgttgaaactgatcctactgctcgctatggccgg
tttgaagaagttcttggcaaaggagcaatgaaaacagtgtacaaggcaattgatgagctt
cttgggatggaagtggcatggaatcaggtgaaactcaatgaagtccttcgctcaccagag
gatttgcaacggctctactcagaggttcacctcctcagcaccctcaatcacgattccata
attcggttctatacctcctggatcgatgttgatcacaaaacttttaacttcattactgaa
atgttcacttcggggactctaagagagtataggaagaaatataagcatgtagacatccga
gccattaagaactgggcccgtcagatccttcgcggtcttgtatatctgcatggcaatgat
cctccagtaattcatagagatcttaagtgtgacaacatctttgtcaatgggcatcttggg
caagtcaaaattggtgatttagggcttgcagcaatcctccgtggttcccaatctgctcac
agtgttataggcactccagagttcatggcaccagaactgtatgacgaaaattacaatgaa
ctagttgatgtctactcattcggcatgtgtgtcttggagatgcttacatctgaataccca
tatagtgagtgtgtcaaccctgcacaaatatacaagaaagttacctcggggaagcttcca
ggagcattctaccggattcaagacttggaagcacaacgattcattggaaaatgcttagta
aatgcttcaaagagattatcggcaaaagaacttttgcttgatccatttcttgagtgtggt
aaaaatgaaccattgcctttgggaaagcttggacgtccaaagccatttttaaatgacaag
gaaatggagaaactgcaattgagtgatgatcaaaccaggactgacatgacaatcacgggg
aagttaaatcctgaagatgacaccatctttctcaaagttcagattgctgataaagatggt
tctcttaggaacatatattttccttttgacatattaaatgatacaccatttgatgttgct
acggaaatggtgaaggaattggagatcactgattgggagccatttgaaattgcgaatatg
attgaaggggagatatctgctctggtaccaaattggaaaactgaagcctaccacacaatt
aattatcaagatgatgatgatggacctcaacgtcctcactctcactcctcctgctcatca
tcccacacatcattatcaggcttgatcagctctcatgggattaacggagtgacaaatggc
tgtgattggctccaagatgatttccttgatgagaccagctctcaaagctcttcacactca
ggaacatattccaacttaaatttcatttgtgggaatgagcatgggactaatacgattccc
acaggaggagacaaacatcccatatcaaaatgtcacaagtccacaaggttttgtcctgaa
gaaaaccgtaatactgggcattctatggctaaaaaatactacgagagatgcaaagctttt
ctagcatctggttcaaaagataaaaggatcgtggatagccgtagattgatgaggaataag
tcgctagtagacgtaagaagtcacctactacaccggtctttggtcgaagaggtgaatagg
aggcgcttgtttaagaccgtgggagccgtggaaaatatcgggtttcaagcaccttgtgag
gtttcaaaaaaattgtaa

DBGET integrated database retrieval system