KEGG   Prunus avium (sweet cherry): 110755282Help
Entry
110755282         CDS       T05161                                 

Definition
(RefSeq) vacuolar protein sorting-associated protein 41 homolog
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
pavi  Prunus avium (sweet cherry)
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pavi04131]
    110755282
Membrane trafficking [BR:pavi04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    110755282
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin WD40 Phage_SSB zf-RING_2
Motif
Other DBs
NCBI-GeneID: 110755282
NCBI-ProteinID: XP_021812155
Position
Unknown
AA seq 961 aa AA seqDB search
MAPIPPDNGVEGDDEREEEGEEEEEEEEEEEEEEDEEEEEEPRLKYQRMGGSIPTLLTSD
VATCIAVAERMIALGTHGGTVHILDFLGNQVKEFPAHTAAVNDLSFDIEGEYIGSCSDDG
SVIINSLFTDEKMRFEYHRPMKAIALDPDYAKKSSRRFAAGGLAGHLYYNTKRWLGFRDQ
VLHSGEGPIHAVKWRTSLIAWANDAGVKVYDTANDQRITFIERPRGSPRPELLLPHLVWQ
DDTLLVIGWGTSIKITSIKTNQSRAANGTVKHVSMPMSNMNQVDIVASFQTSYFISGVAP
FGDSLVVLAYIPGEEDGEKEFSSSVPSRQGNAQRPEVRIVTWNNDELSTDALPVHGFEHY
KAKDYSLAHAPFSGSSYAGGQWAEGDEPLYYIVSPKDVVIAKPRDAEDHIAWLLQHGWHE
KALAAVEAGQGRSELLDEVGSRYLDHLIVERKYAEAASLCPKLLRGSASAWERWVFHFAH
LRQLPVLVPYIPTENPRLRDTAYEVALVALATNPSFHTELLSTVKSWPPVIYSSLPVISA
IEPQLNASSMTDALKEALAELYVIDGQYEKAFSLYADLLKPDIFSFIEKHNLYDSIREKV
VQLMMLDCKQAVPLLIQNKDLITPSEVVKQLLNARDKCDSRYFLHAYLHSLFEANPHAGK
DFHDMQVELYADYDSKMLLPFLRSSQHYKLEKAYEICIGRGLLREQVFILGRMGNAKQAL
SVIINNLGDIEEAVEFVNMQHDDELWEELIQQCLHKPEMVGVLLEHTVGNLDPLYIVNMV
PNGLEIPRLRDRLVKIITNYRTETSLRHGCNDILKADIVNLLVKYYKEAIHGIYLSNEED
EARTKRNDSRASQVIEKSPGVRSMEVKSKPRGGARCCMCFDPFSIQSLNVIVFFCCHAYH
MTCLMDSTYTSGIKGTGATSSERVADNEYDDRVVEEDDDDTQSGDSRMRCILCTTAASRV
R
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
atggctccaattccgccagataacggcgtagaaggagacgatgagagagaggaagagggc
gaagaagaagaagaggaagaagaggaagaagaagaagaggaagatgaagaggaggaggag
gagccgaggctaaagtaccagcgaatgggaggcagcattcctacgctcttgacgagcgat
gtggctacgtgtatcgccgtcgcggaacgaatgatcgcgctcggaactcacgggggcacc
gttcatattctcgattttctcgggaatcaggttaaggaattccctgctcatactgctgca
gtgaatgatcttagctttgacatagaaggtgaatatataggaagctgttcagacgatggg
tctgttataataaacagcctttttactgatgagaaaatgaggtttgagtatcatcgccca
atgaaggctattgctctggatccagattatgcaaaaaaatcttctaggagatttgcagct
ggtggtttagctggtcatttatattataatacaaaaagatggctgggctttagagatcag
gttttgcattctggtgaaggtcctatacatgcagtgaagtggagaacaagtctcattgct
tgggctaatgatgcaggtgtgaaagtatacgatactgcaaatgatcagcgtataacattc
attgaaagaccacgaggaagcccacgacctgagcttttgctccctcacctagtttggcag
gacgacacattgttggtcattggctggggaacatcaatcaaaataacgtcgataaaaaca
aatcagtctagagcagccaatgggacagttaagcatgtctcgatgccaatgtctaatatg
aaccaggtggatattgtggcatcctttcagaccagctatttcatttctggtgttgctcct
tttggtgactctttggtcgttctagcctatatccctggtgaagaagacggggagaaggaa
tttagtagctctgttccatcacggcagggaaatgcacagagaccagaagtacgtattgta
acatggaataatgatgagctttcaacagatgctttacctgtacatggctttgagcattac
aaagcaaaggactattcccttgctcacgctcctttctcaggtagcagctatgctggtggt
cagtgggctgaaggtgatgaaccactgtactatattgtatccccaaaggatgtagtcatt
gcaaaacccagggatgctgaagatcatattgcttggcttcttcaacatggttggcatgaa
aaagctttggctgctgttgaagcaggccagggacggagtgaacttcttgatgaggttggt
tctagataccttgatcatttgattgtggaaagaaaatatgctgaagctgcatctttgtgt
cccaaattgttgagaggatctgcttcagcatgggaaagatgggttttccactttgctcat
ctgcgtcagcttccagtattagtcccatatataccaacagaaaacccaagactacgtgat
actgcttatgaggttgctctagtagcactggctacaaatccatcttttcatacggagctc
ttgtcaactgttaaatcttggccaccggtgatttattcttcattgcctgttatctcagcc
atagaacctcagctgaatgcatcttccatgacagatgctcttaaggaggctctagcagag
ttgtacgtgattgatgggcaatatgaaaaagcattttcactatatgctgatcttttgaag
ccagacatattttccttcatcgaaaagcacaatttatatgattccattcgggaaaaggtt
gtccaactgatgatgctagattgcaagcaggcagttcctttattgattcaaaacaaggat
ttaattactccatctgaagtggtcaaacaacttttgaatgcaagggacaagtgtgattcc
agatatttcttgcatgcatatttgcattcactatttgaagcaaaccctcatgctggaaaa
gattttcatgatatgcaggtagagctttatgcagactacgattcaaagatgctacttcct
tttcttcgtagtagtcaacattacaaacttgagaaggcatatgaaatttgtatcggaaga
ggtcttttaagggagcaagttttcattcttggaagaatgggaaatgcgaaacaagccctt
tctgtaatcataaataatcttggggatattgaagaggctgtggagtttgtaaatatgcaa
catgatgatgaactttgggaagaattaattcagcagtgtcttcataaacctgaaatggta
ggcgtgctactggagcacacagttggaaatctagatcctctatatatagtgaatatggtt
cctaatgggttggagattcctaggcttagggatcgcctagtgaaaatcatcaccaattac
aggactgaaacatctctaagacatgggtgcaatgatatccttaaggctgatattgtcaac
ctcttggtcaaatactacaaagaggcaatacatggaatttacttgagcaatgaagaagac
gaggcacggacgaaaaggaatgatagtagggcttctcaggtgattgagaaatcaccaggt
gtgagaagtatggaggttaaatcaaaacctaggggcggtgcaaggtgttgcatgtgtttc
gatcccttttctatacaaagccttaatgtcatcgttttcttttgctgtcatgcttatcac
atgacttgtcttatggattccacctatactagtggaataaaagggactggggccacttcc
agtgagagagtagcagataatgagtatgatgaccgtgttgtggaagaagatgatgatgat
acccaatcgggtgactctcgtatgcgttgtatcttatgtactactgctgctagtcgagtt
aggtga

DBGET integrated database retrieval system