KEGG   Prunus avium (sweet cherry): 110755665Help
Entry
110755665         CDS       T05161                                 

Definition
(RefSeq) Fanconi anemia group D2 protein homolog
  KO
K10891  fanconi anemia group D2 protein
Organism
pavi  Prunus avium (sweet cherry)
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pavi03400]
    110755665
DNA repair and recombination proteins [BR:pavi03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FANCD2-I complex
     110755665
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FancD2 FANCI_S2
Motif
Other DBs
NCBI-GeneID: 110755665
NCBI-ProteinID: XP_021812594
Position
Unknown
AA seq 1561 aa AA seqDB search
MVFLHQQIPSRKRPASSSFVPPLPPPKSSKPSTTNPTPNDVVETPAIDKMASILADAGCT
LLNHSGPPCLPSDPHKLRRHLHRTFSSSENAPALLSDFLSGLSTYINSSKNLRRILTASG
RSESLVRHLLLVPSIQLQIQNMLLEKLPEYFHVYPEHSGPSLSLEDDIARLIINHFRWLD
FIVDPNALAEKLMLVLSICPLHLKKEIIGSLPEIIGDQNNQTVVQSLEKLLQEDSAVVVP
VLDSFSNLNLDPLLQEQVITIALSCIRTIDAEHMPHLLRFLLLSATLSNARRIISQIRQQ
LKFVGVSNYRTSEKSKLKGKSRVDNTEASILDALRSSLRFKNILCQEILKELNSLEKPQD
HKVIDIWLLMLIYMNGESLQRSIEKVFKKKIIEDCIQEAMFDQCIHGQKELVQDYFLSFI
SLSEYLLACKEPKAQEFGIHMYVCLFEEFADSYSRQEVLGSLVTHVGSSVGFEVSSALET
MALLASKYSQQLIPLSSHINGILDYLEGFSVENLHKVYEIFGHLALLARSSADSYGSSFA
NELLMIVRKQVSHPELNYKKMGLVGILKMVSCLGDATDVTCSSSSQKSNCDEALELLKIA
LDSCKQLPLPLIMFYDELTEMVDYKTLHPTVMEWIGKHVGEFEPLFLSDLDGGNLAVKDS
YCGLEGELWMNLDGDISPICLNILPLASSSSQSASSLQVLPANFLLLSAIERLTNQGSLG
GIDALLGCPLHLPSSKYFFGSEWKSLTGKQKQILCASLYYAANWIRELLNAFCTQVTGIF
EFTSQATKEDIISKLLKRLRNLLFLESLLNNCIGRYSLSLPELHPYVDVYRSSALNQPHR
MGHFEKKLDHKKKHEETSPSGTRTNKKTSKEPTSDTNQKLRQPTLLDVLEKAGVLPGQDV
PNEDSSGLSTKGRSYESSEKNSHDSDGASSIEISAVGKAIEAQRINFRPLLVHCYAISTF
SKGEASCCIDAAAELPLYLYLLRDLHYKLDFFTPGKQLWGRCLSAPVGFTRLTVDGFLSK
IKPLFPSIKRHFDSAVLLLKEGDETCEEHWNIQSTFAGNPNIPNLVLSKSAVSTSVFKEV
LHCFSAILNLPGIQTDKSALSCLLEAFQPTEIPDSLLADIQPNLSPGTTEYLYLGAYAFF
EGVLDIACSFSFMLASESLFTLESVVTSIQKFISKLEGNSKNVHSEFIQEVLPTLRSKLG
ISAQNILRHSWDNEHLENGWKRKGETVQKILRIYLDSSNSTSDLLDKLACSILPQALCER
IGEDDHHGFPSLSSGTFVVWYKILHEENLAVLNKLVKEAVLLKKTSTRAQPETIEKLLSK
LQQSVNVVVSLVNLCKTCAKVTLHAMAVGYGGKFVDSFLKVFDFLESHFQVHNEHIIHLV
LELQKATRTIQTLCSEAKSLRQTSITRKIPATKRSMERFLFCVKALLHTTSNGSSFWMGN
LKHKDLKGQVVSSQVYVDSEDDQVDEEPAEVADEEPAEAADEEPAKAADEEPAEAGGEEP
AKAADEEPAEASDEGQAQAADEEPAEASDEEPAEASDEEQAEAADDYPPVSVASEEDRET
E
NT seq 4686 nt NT seq  +upstreamnt  +downstreamnt
atggtgttcctccaccagcaaatcccttcacgcaagcgaccggcctcctcttctttcgtc
cctcctttgcctccccccaaatcttccaaaccctccaccaccaatccgaccccaaacgac
gtcgtcgagaccccagccatcgacaaaatggcgtctatactcgccgacgctggctgcacc
ctactcaaccactcgggcccaccgtgcctcccttcggaccctcacaagctccgccgccac
ctccaccgcactttctcctcttccgaaaatgcccctgctcttctctccgatttcctctcc
ggtctctccacctacatcaactcctccaaaaacctccgcaggattctcaccgcctccggc
agaagcgagagcttagtccggcacctactgctggtcccctccatccaattacagattcag
aacatgcttctcgagaagcttccagagtatttccatgtatatccggaacattccggtcca
tcgctgtctcttgaagacgacatcgctaggcttatcatcaatcacttccggtggctcgat
ttcattgtggatccgaatgccttggctgagaaattgatgctggttctttcgatttgcccg
ctgcatttgaagaaagagatcatcggatcgttgccggagatcatcggagatcagaataac
cagactgtggttcaatctcttgagaaattgctccaggaagactcggctgttgttgtgcct
gtgcttgactccttttcgaatcttaatttggatcctctgttgcaagagcaggtaatcacc
atagcattgtcatgcatcagaacaatcgatgcggagcacatgcctcatctgcttaggttt
ttactgctttcagcgacactgtcaaatgcacggagaataatctcacagatccgtcagcag
ttaaaatttgttggagtttcaaattatcgtacatcagaaaagagtaaactcaaagggaag
tcgcgtgtggacaacacagaggcttcaattcttgatgcgttgagatcaagtcttcgattt
aagaatatactatgtcaggagattttgaaagagttaaacagtcttgagaaacctcaggat
cacaaagtcattgatatatggctactaatgctgatatacatgaatggtgaatccctgcaa
aggagcattgaaaaggtattcaagaagaaaattattgaagattgcattcaggaagctatg
tttgatcaatgcattcatggacaaaaggagctggtacaggattactttctatctttcatt
tctctgtctgagtacctgttggcttgcaaagagccaaaagcccaggagtttggcatccat
atgtatgtttgtctctttgaggagtttgctgatagttattcaagacaggaagttcttggt
tcgctggttacccatgtgggctcaagtgtgggttttgaagtcagttctgctttagagaca
atggctttgctggcctccaaatattcacagcaattaattcctctttcttctcatattaat
ggtatccttgattacttagagggatttagcgttgaaaatttgcacaaggtctacgagatt
tttggccatctggcacttttggctcggtctagtgcagattcatatggttcttcctttgca
aatgaacttttgatgatagtacggaagcaggtcagtcatccagaactgaattacaagaag
atgggccttgtcggaattctgaagatggtttcctgtctaggagatgcaactgatgttacc
tgttcatcctcatctcaaaaatcaaattgtgacgaggctttggaactcttgaaaatagct
ttggactcttgcaaacagttgcccttacctttgatcatgttttatgacgaactgactgaa
atggtggattataaaacacttcatccaacagttatggaatggattgggaaacatgtagga
gagtttgaacctctgtttctgtctgatcttgatggtgggaatttggctgttaaggactca
tattgtggtttagaaggggagctgtggatgaacttggatggtgatatatcaccaatatgt
ctaaacattttgccattagcttcctcttcatcgcagtctgcttcttctttacaagttctt
cctgctaacttccttttattatctgcaattgaaaggctgacgaatcaaggatcccttggt
ggaattgatgcactacttggctgccctttgcacctgccttcttccaagtatttctttgga
tctgagtggaagtctctgacagggaagcagaaacagattttgtgtgcctctctatattat
gctgccaattggatacgggagctactcaatgccttctgtacacaagttactgggatattt
gaatttacaagccaggctacaaaggaggatataatttccaagctattgaagcgtttgagg
aaccttctatttttggaaagcttgttaaacaattgcattgggaggtactctctatctctt
cctgaacttcatccttatgtggatgtctaccgttcttctgcgttaaaccaacctcaccgt
atggggcactttgaaaagaaacttgaccataagaaaaaacatgaggaaacctctccaagt
ggcacaaggacaaataaaaagacctcaaaggaaccaacatcagataccaaccagaagctc
cggcagcctacattattggatgtcttagagaaagcgggagttctaccaggccaagatgtg
ccaaatgaggattcttctggtttatctacaaagggaaggtcatatgagtcatcagagaaa
aattcccatgactctgatggggcgtcctctatagaaatttctgcggttggcaaggctatc
gaagctcagaggattaatttcagacccctcctagttcattgttatgccatttcgacattt
tcaaagggtgaagcctcctgctgtatcgatgctgctgctgagttacccctatatctgtac
cttctgcgtgatcttcactacaagctggatttcttcacccccggaaaacaattgtggggt
agatgcttgagtgctccagttgggttcaccaggttgacggtagatggatttttgagcaaa
attaaaccactctttccgagtattaagaggcattttgatagtgcagttttgttactgaag
gaaggggatgaaacttgcgaagaacattggaatattcaatctacttttgctggaaatcca
aatattcccaatcttgtactttcaaaatctgcagtttctacttcagtattcaaagaagtg
cttcattgcttcagtgcgatattaaaccttcctggtattcagacggacaagtcagctctc
tcatgtctgctagaagcattccagcctacagagattccagatagcttattggcagacata
caacctaacctttctcctgggactacagagtatttatatttgggtgcttatgcatttttt
gaaggtgtcttggacatagcatgctctttctcctttatgctggcttcagaatcacttttt
actctagaatcggttgtaacctcaatccagaaattcatcagtaagttggagggaaatagt
aaaaacgtgcactcagaatttatccaggaagttcttccaactttgcgcagcaaacttggt
atttctgctcagaatattttaaggcatagttgggataatgaacatcttgagaatggttgg
aagagaaaaggagaaacagtacagaaaatattgcgcatctacctggacagtagcaactca
acttctgacctgctggataagctagcctgctctattttgcctcaggctttatgcgaacga
attggagaagatgatcatcatggtttcccatctctaagttctggaacatttgttgtgtgg
tacaagatactgcatgaagagaatcttgctgttcttaacaaattggtcaaggaagctgtt
ctcctaaagaaaaccagtactcgtgctcaacccgaaactattgaaaaacttctaagcaag
ctgcaacagtctgtaaatgtggttgtgtcattagttaacctttgtaaaacttgtgccaag
gtgactctgcatgccatggctgttggttatggagggaagtttgttgattccttcctgaaa
gtttttgacttcttagagtcccactttcaagttcacaatgagcatataatccacttggtt
ttagaacttcaaaaggccacaagaacaatacagaccctatgttctgaagcaaagagcttg
agacaaacaagtataaccagaaaaattcctgctacaaagagatctatggaacgcttttta
ttctgtgtgaaagctcttctccatacaacatcaaatgggtcttctttctggatgggcaac
ctgaagcataaagacttgaaaggtcaggtggtgagttcccaagtgtatgtggattctgaa
gatgatcaagttgatgaagagccagccgaagtcgctgatgaagagccagctgaagctgct
gatgaggagccagccaaagctgctgatgaggagccagccgaagctggtggtgaagagcca
gccaaagctgctgatgaagagccagccgaagcttctgatgaagggcaagcccaagctgct
gatgaagagccagccgaagcttctgatgaagagccagccgaagcttctgatgaagagcaa
gctgaagctgctgatgattatccacctgttagtgttgctagtgaagaggacagagaaaca
gaatga

DBGET integrated database retrieval system