KEGG   Prunus avium (sweet cherry): 110756311Help
Entry
110756311         CDS       T05161                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: non-specific phospholipase C2-like
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
pavi  Prunus avium (sweet cherry)
Pathway
pavi00562  Inositol phosphate metabolism
pavi00564  Glycerophospholipid metabolism
pavi00565  Ether lipid metabolism
pavi01100  Metabolic pathways
pavi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110756311
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    110756311
   00565 Ether lipid metabolism
    110756311
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:pavi02042]
    110756311
Enzymes [BR:pavi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     110756311
Bacterial toxins [BR:pavi02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   110756311
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphoesterase
Motif
Other DBs
NCBI-GeneID: 110756311
NCBI-ProteinID: XP_021813416
Position
Unknown
AA seq 512 aa AA seqDB search
MGTSTTISVLFLMLIALHSPIYANPIKTIVVIVMENRSFDHMLGWMKRINPEINGVDGSE
ANPLSTTDPNSKLFFFNNESHYVDPDPGHSFQAIREQIFGSDNTSADPPPMNGFAQQAFS
MDNTTTMSQDVMNGFNPDMVAVYKTLVSEFAVCDRWFASVPSSTQPNRLYVHSGTSAGAT
SNIPALLVKGYPQRTIFESVYDAGISFGIYYQNIPATLFYRNLRKLKYISKFHMYDTFKS
HAKQGKLPGYTVVEQRYFDVKIAPANDDHPSHDVFQGQMFVKEVYETLRSSPQWNDTLLI
ITYDEHGGFYDHVGTPVHGVPSPDGIVGPEPFLFRFDRLGVRVPTIMVSPWIEKGTVLHG
PNGSPFPTSEFEHSSIPATVRKIFNLSAPLTKRDEWAGTFEGIVQTRTEPRTDCPEQLPT
PVKIRKSEPKEDAKLTEFQQEMTQLAAVLKGDNIFTSYPKKTGKEMTVKDGKEYADDAVK
RFFEAGLYAKRMGVSEEQIVQMRPPLLQDHHP
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgggcactagcaccaccatttcagtcctgtttttgatgctcatagcccttcacagtcca
atatatgccaatcccatcaaaactattgttgtaattgtgatggagaacaggtcatttgac
cacatgctgggttggatgaagagaatcaatccagaaatcaacggtgtggatggctctgag
gccaaccctttgtccacaactgatccaaactccaagctcttcttcttcaacaatgagtct
cactatgtggaccctgatcctggccactcatttcaggccatcagagagcaaatcttcggc
tcagataacacctcagctgacccgcctcccatgaatggctttgcccagcaggctttctcc
atggacaacaccaccaccatgtctcaagatgttatgaatggcttcaacccggatatggtt
gctgtctataaaactcttgtttctgaatttgcagtctgtgacaggtggtttgcctcggtc
ccatcctcaacacagccgaatcgcctctacgtgcattcagggacatcagctggggcaaca
agcaacatcccagcccttctagtcaagggctacccgcaaagaaccatcttcgaaagcgtt
tacgacgccggaatatccttcggaatatactaccaaaacattccggccacactcttctat
aggaacttgaggaagctcaagtacataagcaagttccacatgtatgacaccttcaagagc
catgcaaagcaagggaagctgccaggctacactgtcgtagaacagaggtactttgacgtc
aagattgccccggcaaatgatgatcatccctcgcacgacgtgttccaagggcagatgttt
gtcaaggaggtgtacgagacactgaggtcgagccctcagtggaacgacaccttgttgatc
atcacttatgatgaacatggagggttctacgatcatgtaggtacgccggtacatggagtc
cctagccccgatgggatcgtggggccggagcctttcttgtttcgatttgaccggttggga
gttagggttccgaccatcatggtctcaccctggattgagaagggtactgtccttcatgga
cctaatggatcaccatttccaacttcggaatttgaacactcatccattccagcaacagtt
aggaagatcttcaacctatctgcacccttaacaaagagggatgaatgggctggtaccttt
gaaggcattgttcaaacacggacagaacccagaactgattgcccagagcaactaccaacg
ccagtcaagatcagaaaaagtgagcctaaagaagatgctaagcttactgaatttcagcag
gagatgacacaactcgcagcagttctaaaaggagataacatatttacaagctaccccaaa
aagacagggaaggagatgaccgtcaaggatgggaaggaatacgcagatgacgcagttaaa
cgattctttgaggcagggctttatgctaagagaatgggagttagtgaggaacagattgtc
cagatgaggcctcccttactacaagaccatcacccatag

DBGET integrated database retrieval system