KEGG   Prunus avium (sweet cherry): 110758004Help
Entry
110758004         CDS       T05161                                 

Definition
(RefSeq) sphingosine kinase 1 isoform X1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
pavi  Prunus avium (sweet cherry)
Pathway
pavi00600  Sphingolipid metabolism
pavi01100  Metabolic pathways
Module
pavi_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    110758004
Enzymes [BR:pavi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     110758004
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat THF_DHG_CYH
Motif
Other DBs
NCBI-GeneID: 110758004
NCBI-ProteinID: XP_021815470
Position
Unknown
AA seq 493 aa AA seqDB search
MDRPESAQPQPVLSDRVLINGTVTSVTLFADGVLRWSERGQRSLIVEKEILGFAAEGPKI
RIRALVEDGDGICCVASRGAVVRKEFVFKPLSEDSHRLWCQKLREHIDSLGRPKRLFVFV
NPFGGSKSASKIYAEHVKPLFQDANIQFTLQETQYQLHAKEVAKTLDLSKYDGIVCVSGD
GILVEVVNGLLEREDWEAAIKMPLGVVPAGTGNGMAKSLLDSVGEPCTASNAILAIIRGN
KRSLDVATIRQGKTKFFSVLMLAWGLVADVDIESEKYRWMGSARLDFYAVQRIVHLRQYN
GSISFVPAPGFEAYGEPTSYNNISEPTNHHKKCGPSQEEPVNIRQHGYEGPDINLENMDW
RTISGPFVSVWLHNVPWGSEDTKAAPNAKFSDGYLDVIIMRACPKLSLLSLMSGLNTGSH
VNSPYVMYFKVKALILEPGPLTEDPTKGGIIDSDGEVLARGERAYKCDQKTLMAYDKLQI
TVDQGLATLFSPV
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggaccgacccgagtccgctcaaccgcaacccgtactctccgaccgggtcctcataaac
ggcaccgtcacttcggtgactctattcgccgatggagttctccggtggtcggagagaggt
caacggagcttgatcgtggagaaggagatcctcgggttcgcagcagaaggtccgaagatc
aggatcagagccttagtggaagacggagatggaatctgctgcgtcgcgagcagaggagct
gtggtgaggaaagaattcgtcttcaagcctctctctgaggactcgcataggctctggtgc
cagaagctccgcgaacacattgattctctggggcggccaaagaggctcttcgtttttgtg
aatccatttggtgggagcaaatccgcttcaaaaatatatgctgaacacgtaaaacctctt
ttccaggatgctaatatccaatttacactacaagaaactcaatatcaactacatgcgaag
gaagttgctaaaacactagatctttcaaagtatgatggcattgtttgtgttagtggggat
ggaatcttggttgaggtagtaaatggactccttgagagagaggattgggaagctgcaata
aagatgcctcttggagtagttcctgcaggtacaggaaatggaatggcaaaatctcttttg
gattctgttggtgaaccttgtacagcatctaatgctattcttgccattattcgagggaat
aagcgttcattggatgtagctaccataaggcaggggaagaccaaattcttcagtgtattg
atgcttgcatggggtttagtggcggatgttgatattgagtctgagaagtataggtggatg
ggaagtgctcgtctagatttctatgctgttcaacgaattgtgcatttgaggcaatataat
ggatctatttcctttgtgcctgcacctggctttgaagcttatggggagcctactagttac
aacaacattagtgaacctactaaccatcacaaaaaatgtggtccaagtcaagaggagcct
gttaacattcgacagcatggctatgagggacctgatattaacttggagaacatggactgg
agaactattagtgggccattcgtttcagtctggcttcacaatgtcccttggggaagtgaa
gacacaaaggcagcgcctaatgccaagttctcagatggttacctagacgtgataattatg
agggcttgcccaaaactatccttgctctcgttgatgtcagggctgaacacaggaagtcat
gtcaattcaccatatgtcatgtacttcaaggtgaaagcattaattttggaaccaggtcct
ctaactgaggaccccacaaagggagggattatagactcagatggtgaggtcctggctagg
ggcgaaagagcatacaaatgtgaccaaaagacactgatggcctatgataaacttcaaatt
actgtggatcaaggtttagctactctgttttccccggtataa

DBGET integrated database retrieval system