KEGG   Prunus avium (sweet cherry): 110761929Help
Entry
110761929         CDS       T05161                                 

Definition
(RefSeq) uncharacterized protein LOC110761929
  KO
K15891  NAD+-dependent farnesol dehydrogenase [EC:1.1.1.354]
Organism
pavi  Prunus avium (sweet cherry)
Pathway
pavi00900  Terpenoid backbone biosynthesis
pavi00909  Sesquiterpenoid and triterpenoid biosynthesis
pavi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    110761929
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    110761929
Enzymes [BR:pavi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.354  farnesol dehydrogenase (NAD+)
     110761929
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Epimerase 3Beta_HSD GDP_Man_Dehyd NAD_binding_4 NAD_binding_10 NmrA Polysacc_synt_2 RmlD_sub_bind adh_short
Motif
Other DBs
NCBI-GeneID: 110761929
NCBI-ProteinID: XP_021820202
Position
Unknown
AA seq 340 aa AA seqDB search
MKILLTGASGYLGGRLCHELLKQGHSVRALVRPTSDLSSLPPPSPTGNGGLELVYGDVTD
YNSLLSAFSGCDVVFHAAAVVEPWLPDPSKFFSVNVGGLKNVLRAVRETKTVQKVIYTSS
FFALGPTDGHVANEAQVHHEKFFCTEYEKSNAAADKIALQAAQQEELPLVLLYPGVIYGP
GKLTAGNVVARMIVERFNGRLPGYIGSGNDRYSFSHVDDVVEGHIRAMEKGRTGERYLLT
GENASFKHVFDVAAVITKTQRPKFGIPLWLIEVYGWASVLFSRITGKLPLISPPTVYVLR
HQWAYSCEKAKQELDYSPRGLKEGLGEVLPWLKNLGLIKY
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaagatactgttgaccggcgcctccggttatttaggaggcagattgtgccacgagcta
ctgaaacaaggccattccgttcgcgccttggtccgcccaaccagcgacctctcctccctg
cctccaccgtcaccaaccggtaacggtggcctcgaactcgtctacggcgacgtcaccgac
tacaactccctcctctccgccttctccggctgcgacgtcgttttccacgcagccgccgtg
gttgagccctggcttcccgacccctccaagttcttctccgtcaacgtcgggggattgaag
aacgtgctgcgagcggttcgagagacgaagaccgtacagaaggtcatctacacgtcgtcg
ttcttcgccctcggaccgaccgatggccacgtcgccaacgaggctcaggtccatcacgag
aagttcttctgtacggagtacgagaaatcgaacgctgccgccgataaaatcgcgctacag
gccgcgcagcaagaggagctgccgttggtgctgctttatcccggagtgatctacgggccc
ggaaagctcaccgctggaaacgtcgtcgctcggatgatcgtcgagcggttcaacggccga
ttgcctggatatataggctccgggaatgataggtattcgtttagccatgtcgatgatgtt
gtggagggccatatcagagctatggaaaaaggtcgaacaggtgagaggtatctgctaaca
ggtgaaaacgcatcgtttaagcacgttttcgatgtagcagctgtgatcactaagacgcag
aggcctaaatttgggatcccattgtggttgattgaggtgtacggatgggcgtctgttctt
ttctctcgaattacagggaagcttcctctgattagtcctccgactgtttatgttttgagg
catcaatgggcatattcatgtgagaaggcgaagcaggagctggattatagtcccagagga
ttgaaagaaggattgggggaggtgttgccttggctcaagaacttgggcttgatcaaatat
tga

DBGET integrated database retrieval system