KEGG   Prunus avium (sweet cherry): 110764040Help
Entry
110764040         CDS       T05161                                 

Definition
(RefSeq) beta-glucosidase 12-like isoform X1
  KO
K01188  beta-glucosidase [EC:3.2.1.21]
Organism
pavi  Prunus avium (sweet cherry)
Pathway
pavi00460  Cyanoamino acid metabolism
pavi00500  Starch and sucrose metabolism
pavi00940  Phenylpropanoid biosynthesis
pavi01100  Metabolic pathways
pavi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    110764040
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    110764040
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    110764040
Enzymes [BR:pavi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     110764040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 110764040
NCBI-ProteinID: XP_021822636
Position
Unknown
AA seq 516 aa AA seqDB search
MAMQLRSFLLGILLLIGFVFTNSEANIRAPPTHFDTASLNRSSFPEGFIFGVGSGSYQYE
GAAKEGGRGPSIWDTFTHKYPEKINDSSNGDIAVDQYHRYKEDVGIMKNMGWDAYRFSIS
WSRLLPNGKLSGGVNREGIKYYNNLINELLRNGLTPFVTLFHWDPPQTLEDEYGGFLSPR
IVNHFQDYAELCYKEFGDRVKHWSTLNEPYIFSYNGYAIGANAPGRCSTWQQLNCTGGDS
SIEPYLVTHHQLLAHAAAVKLYKNRYQVSQKGLIGTTLNSHWFEPLSEEKENKNAALRAL
DFMFGWFIEPLTSGDYPQSMRSLVGSRLPKFTKEQSKLLIGSFDFLGLNYYAGYYASDAP
QNNSVYTSYTTDDGVNLSSERNGVPIGPKGASEWLNVYPRGIQRLLLYTKKKYHNPIIYI
LENGVDELNDPKLSLAEALNDTHRIDYYKSHLHYVQSSIDNGVKVKGFFPWTLLDDFEWS
SGFSVRFGITYVDYNDGLKRHPKLSAHWFKSFLKKY
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgcaattacgttcttttctcttaggcatactgctactaattggctttgttttc
acaaatagtgaagctaatattagagctccacccacacattttgacactgcttctctcaat
aggagcagttttccagaagggttcatatttggtgtaggttctggatcttaccaatatgaa
ggtgctgcaaaagaaggtggtagaggaccaagcatttgggataccttcacccacaaatat
ccagaaaagattaatgatagcagcaatggagatatcgctgttgatcaatatcaccgctat
aaggaagatgtggggattatgaagaatatggggtgggatgcttaccgattctctatctca
tggtcaagattgttaccaaatggaaagttaagtggaggagtgaacagggaaggaatcaaa
tattacaacaatctcatcaatgagctcttacgcaatggtttaacgccatttgtgacactc
ttccattgggatcctccccaaactttagaagatgaatatggtggtttcttaagccctcgt
attgtcaatcattttcaagattacgcagaactttgttataaggaatttggtgatcgagta
aagcattggagcacactgaatgagccatatatcttcagttataatggttatgcaatcggg
gcaaatgcgccgggacgatgctccacttggcagcagctgaactgcaccggcggagattca
tctattgaaccatatttggtaacacaccaccagctcctagctcatgcagctgccgtaaaa
ttgtacaaaaatagataccaggtgtctcaaaaaggtttgatagggacaacactgaattca
cattggtttgagcccttatcggaagaaaaagaaaataaaaatgctgcattacgagctttg
gattttatgtttggatggtttattgagccattgacaagtggtgactatccgcaaagcatg
cgatctcttgtcggaagccgattaccaaaattcacgaaagaacaatcaaagttgctaatt
ggttcatttgattttcttggactaaattactatgcgggttactatgcaagtgatgcacct
caaaataactcagtatacacgagctacacaacagatgatggcgttaatctttcatctgag
cgtaatggggtccccatcggtccaaagggtgcttcggaatggttaaatgtttatccacga
ggaattcaacgtcttttactctacacaaagaaaaagtatcacaatccaattatttacatt
cttgaaaatggtgtggatgagttgaatgatccgaaattatcacttgccgaagcccttaat
gatacccacagaattgactactacaaaagccaccttcattatgttcaaagttctattgac
aacggtgtcaaagtgaagggattctttccgtggacgttgctagacgactttgaatggagt
tcgggattcagtgttcgatttggtatcacctacgtagattacaacgatgggcttaaaagg
cacccaaaactctcggcacactggttcaaaagtttccttaagaagtactga

DBGET integrated database retrieval system