KEGG   Prunus avium (sweet cherry): 110765069Help
Entry
110765069         CDS       T05161                                 

Definition
(RefSeq) lactosylceramide 4-alpha-galactosyltransferase-like
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
pavi  Prunus avium (sweet cherry)
Pathway
pavi00601  Glycosphingolipid biosynthesis - lacto and neolacto series
pavi00603  Glycosphingolipid biosynthesis - globo and isoglobo series
pavi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    110765069
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    110765069
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pavi01003]
    110765069
Enzymes [BR:pavi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     110765069
Glycosyltransferases [BR:pavi01003]
 Glycan extension
  P blood group
   110765069
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug TcdA_TcdB Caps_synth
Motif
Other DBs
NCBI-GeneID: 110765069
NCBI-ProteinID: XP_021823810
Position
Unknown
AA seq 430 aa AA seqDB search
MTMSRMDSRLLSLAKFHIFCTLSLAAIIFIFYADSIIYNDSEKSVELNDKAPSPVLLQTH
SSAGHLIKSDINRIALRSMQEETLEVGREITSPLVPPFNATEEERIAWFRSKLPEFEIFK
SDKFARQFHGRVLEFFNNKCEGQFFMTWISPVRSFGSREFLSMESLFRAHPHGCLMILSR
TMDSRRGYRILKPLQDRGFKVHAVTPDLSFLFKNTPAEAWFAEMKGGKKDPGEIPLAQNL
SNLMRLAILYKYGGVYLDTDFIVLNSFLGLRNSIGAQSVDVASKNWTRLNNAVLVFDMNH
PLLYKFLEEFALTFDGNKWGHNGPYLVSRVVQRVQNRPGYNFTILPPIALYPVDWNRIGG
LFKKPGSQAHSRWVKAKLLQLSRETYGVHLWNKQSSRVAIEEGSIMQRLISDHCVICSDI
YSSERIFSNE
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgagccgaatggacagccgcctacttagccttgctaaatttcatatcttctgt
actctatcattggctgcaatcatcttcatcttctatgccgatagcatcatctacaatgac
tctgaaaaatcggttgagttgaatgataaagctccttctccagtcctgctgcagactcat
agttctgcaggccatttgatcaagtctgatataaatcgcatagctctgcgttccatgcag
gaagagacccttgaggttggtagagaaattacaagtcctcttgttcctcctttcaatgcc
acagaagaggaaagaatcgcttggtttcggagcaagctacccgaatttgagattttcaaa
tcagacaagtttgcaaggcaattccacggtcgtgttctggaattctttaacaacaagtgt
gaggggcagttctttatgacatggatttcgcctgtgaggtcctttggaagcagagagttt
ttgtccatggagagtcttttcagagctcaccctcatgggtgcttgatgattctctcgaga
actatggactcccgacgtggttacagaattctgaaaccgctgcaggatcgcgggttcaag
gttcatgcagtgacaccagacttatcatttctgttcaagaacaccccagctgaagcctgg
tttgctgaaatgaagggaggcaaaaaagaccctggtgagatcccattagcccagaatctg
tctaatttgatgaggcttgcaattctatacaagtatggaggtgtttacttagacacagat
ttcatagttttgaattcattcttggggttgagaaactcaatcggtgcacaaagtgtggat
gtggcatctaaaaactggaccaggctaaataatgcagttctggtgtttgatatgaatcat
ccccttctgtacaaattcttggaggaatttgccttgacttttgatgggaataaatggggg
cacaatggtccgtacctggtgtccagagtggtccagagggtgcaaaaccgaccaggttac
aactttacaattctaccccctatcgccctttacccggtcgattggaataggattggggga
ctgtttaagaagccaggaagccaagctcattctcgatgggtaaaagcaaagctgcttcag
ctcagcagggagacttatggggtacacttgtggaacaagcaaagtagccgagtcgcgatc
gaagaaggaagcattatgcagagattaatctccgatcattgtgtcatttgcagtgacata
tacagttctgaaagaattttctcaaacgaataa

DBGET integrated database retrieval system