KEGG   Prunus avium (sweet cherry): 110769142Help
Entry
110769142         CDS       T05161                                 

Definition
(RefSeq) acyl-coenzyme A oxidase 3, peroxisomal-like
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
pavi  Prunus avium (sweet cherry)
Pathway
pavi00071  Fatty acid degradation
pavi00410  beta-Alanine metabolism
pavi00592  alpha-Linolenic acid metabolism
pavi00640  Propanoate metabolism
pavi01040  Biosynthesis of unsaturated fatty acids
pavi01100  Metabolic pathways
pavi01110  Biosynthesis of secondary metabolites
pavi01212  Fatty acid metabolism
pavi04146  Peroxisome
Module
pavi_M00087  beta-Oxidation
pavi_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    110769142
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110769142
   00592 alpha-Linolenic acid metabolism
    110769142
   01040 Biosynthesis of unsaturated fatty acids
    110769142
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110769142
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    110769142
Enzymes [BR:pavi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     110769142
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_ox_N
Motif
Other DBs
NCBI-GeneID: 110769142
NCBI-ProteinID: XP_021828754
Position
Unknown
AA seq 672 aa AA seqDB search
MDRVTWRTQVLSNHINQSSMSSPLSPNPCVGFSPPELSEPFEFDTTEMRKLLDAHNLEDR
DWLFGLMKQSKLFNPREAGGRVFVSPDYNQSMEQQREMTMKRIAYLLDRGVFEGWLTEKG
VEAELRKLALHEVIGIYDHSLAVKLGVHFFLWGGAIQFFGTKRHHDKWLRDTENYTIKGC
FAMSELGHGSNVRGIETVTTYDSNTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLNI
SGKNQGVHAFIAQIRDANGNICPNIRIADCGHKIGLNGVDNGRIWFDNVRIPRENLLNSV
ADVSLDGQYLSAIKDPDQRFAAFLAPLTSGRVTIAVGAIYSSQISLAIAIRYSLTRRAFS
VTPKGPEVLLLDYPSHQQRLLPLLAKTYAMSFAANHLKMIYVKRTPELSKTIHVVSSAFK
ATLTWHNMRTLQECREACGGQGLKTENRIGPLKGEYDVQSTFEGDNNVLMQQVSKALLAE
YIAAQKRSKPFKALGLEHMNKPCPVIPSQLTSSTLQSSQFQMDAFCLRERDLLNRFAMEV
SERQKQGESKEYSVILSYQLAQDLGRAFSDRTILQTLLDAEAGVPSGSLKNVLAMLRSMY
ALICLEEDPAFLRFGYLSTDNVAAVRKEVSRLCGELRPHALALVSSFGIPDAFLSPIAFN
WIDANSWSSVRH
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atggatcgcgtcacatggcgaacccaagtcctctcgaatcatatcaaccaatcttctatg
tcctcgcctctctcccccaacccatgcgtcggcttttctcctcctgagctctccgagccc
ttcgaattcgataccacggagatgcgcaagctcctggacgcccacaatcttgaggaccgg
gactggctctttgggctgatgaagcagagcaagctgtttaatcccagagaggccggtggc
cgagtatttgtctcgcctgactacaaccaaagcatggagcagcagagagagatgaccatg
aagcgaattgcctacttgttggatcgtggggttttcgaaggttggcttacggagaaaggg
gtcgaagctgagttgagaaagcttgcgttgcatgaggttattgggatttatgatcactcc
cttgctgtgaagctcggtgtccatttctttttgtggggtggtgccattcagtttttcggc
acaaagcgccatcacgacaagtggctgagggacactgagaattatacaatcaagggttgc
tttgcaatgtcagagttggggcatgggagtaatgttcgaggaattgaaacagtcaccaca
tatgattcaaatactggagaatttgtcattaatactccttgtgaatcagctcagaagtat
tggattggaggagcagctaatcatgccacacacacaatagtcttttcacaactcaatata
tctgggaaaaaccaaggtgtccatgcttttatagcccagatccgggatgcaaatggtaac
atctgtccaaacattcgtattgctgactgtggtcataaaattgggttaaatggtgttgat
aatggtcgaatatggtttgacaacgttcgaatccccagggaaaatttgttaaattcagtg
gctgatgtttctctagatgggcaatatctgagtgcaataaaagacccagatcagagattt
gcagcattcttggctccattaacatctggtcgtgtaacgatagcagttggtgcaatttac
tcatcacagataagtttagcaatagccataaggtactcactgacaaggcgggccttttct
gttacgccaaaagggcctgaagtcctattgctcgactaccctagtcatcaacagcggctt
ttgcctcttcttgcaaagacatatgctatgagttttgctgcaaatcacttaaaaatgatc
tatgttaagcggacgcctgaattgagcaaaaccatccatgttgtttctagtgcattcaaa
gctacactgacctggcataacatgcgaactcttcaggaatgccgtgaagcctgtggaggg
caaggtctgaagactgaaaaccgtattggtcctctcaaaggtgaatatgatgtgcagtcc
acttttgagggggacaacaatgttctgatgcagcaggtcagcaaagcacttcttgcggag
tatatagccgctcaaaagagaagtaaaccatttaaagctttgggattagaacacatgaat
aaaccttgtcctgtcattccatctcaacttacaagttctaccctccagagtagccaattc
cagatggatgctttctgcttaagagagcgagatctactgaatcgctttgctatggaagtg
tcagaacgtcaaaaacagggagaaagcaaagaatactcggtcattctgagttatcaactt
gcccaagatctaggcagagctttctcagatcgaacaatattgcaaaccctcctagatgct
gaggcaggtgtaccttctggttcattgaagaatgtcttagctatgttgaggtccatgtat
gcattgatttgcctggaagaagacccggcgttcctccgatttgggtacttatcaactgat
aatgttgctgctgtgaggaaagaagtaagcagactgtgtggtgaactgcgaccgcatgca
cttgccttggtcagttcctttggcatccctgatgcttttctgagtcctatagcttttaac
tggattgatgcaaattcgtggtcttcagttcggcactag

DBGET integrated database retrieval system