KEGG   Prunus avium (sweet cherry): 110771532Help
Entry
110771532         CDS       T05161                                 

Definition
(RefSeq) mitogen-activated protein kinase homolog NTF3
  KO
K20535  mitogen-activated protein kinase 1/2 [EC:2.7.11.24]
Organism
pavi  Prunus avium (sweet cherry)
Pathway
pavi04016  MAPK signaling pathway - plant
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    110771532
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pavi01001]
    110771532
Enzymes [BR:pavi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     110771532
Protein kinases [BR:pavi01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   110771532
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Haspin_kinase Kinase-like APH Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 110771532
NCBI-ProteinID: XP_021831538
Position
Unknown
AA seq 372 aa AA seqDB search
MATQVEPPNGIRSPGKHYYSMWQTLFEIDTKYVPIKPIGRGAYGIVCSSVNRETNEKVAI
KKINNAFENRIDALRTLRELKLLQHLRHENVIALKDVMVPVQRKSFKDVYLVYELMDTDL
HQIIKSSQPLSNDHCQYFLFQLLRGLKYLHSANILHRDLKPGNLLINANCDLKICDFGLA
RTSTGKGQFMTEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAELLGRKPIFPGTECL
NQLKLIINILGSQREEDLQFIDNHKAKKYIRSLPYSLGTPFSHLYPDAHPLAIDLLQKML
IFDPSKRISVLEALQHPYMSALYDTSNNPPAEVPIDLDIDEDLGEETIREMMWKEMLHYH
PEAAAGNAELFS
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggcgactcaagttgagcctccaaatgggattagatcgccaggaaagcattactattcc
atgtggcagaccctgttcgagatcgataccaaatacgtgccgatcaaaccgatcggtcga
ggagcgtacggcatcgtttgctcttccgtgaaccgggaaacgaacgagaaagttgcgatt
aagaagatcaacaatgcgtttgagaaccgaattgatgcgctgaggacgctgcgggaactg
aagctgctgcagcatcttcggcatgaaaatgtgattgctttgaaggatgtgatggtgcca
gttcaaaggaagagcttcaaggatgtctacttggtgtatgagctcatggatacggatctg
caccagattattaagtcctcccaaccactttctaacgatcactgtcagtatttcctcttc
cagctgcttcgaggcctaaagtatctccattctgcaaacattctccatcgtgacttgaag
cctggcaaccttcttatcaatgcgaactgtgacttgaagatatgtgattttggactagca
cgtactagcacaggaaagggccagttcatgactgagtatgttgtcactcgttggtaccgt
gcccctgagctcctcctctgctgtgacaactatggaacatccattgatgtgtggtccgtt
ggatgcatctttgctgagcttcttggccggaaacctatcttccctggtacagagtgtcta
aaccagctcaaactcattatcaacatccttggcagccagagggaggaggatctccaattt
atagacaaccataaggcgaagaagtacataagatcactgccatattctcttgggaccccc
ttctcccatctctatcctgatgcccatcctttggcaatcgatctactgcaaaagatgctt
attttcgacccatcaaagaggatcagtgtccttgaagcactccaacacccttacatgtcc
gcgttgtatgataccagtaataaccctccagccgaggtaccaatcgatcttgacatagac
gaggatttaggagaagagacaataagggagatgatgtggaaggaaatgcttcattaccac
cctgaagctgctgcaggcaatgcggaactgttttcctga

DBGET integrated database retrieval system