KEGG   Prunus avium (sweet cherry): 110772591Help
Entry
110772591         CDS       T05161                                 

Definition
(RefSeq) cyanogenic beta-glucosidase-like
  KO
K01188  beta-glucosidase [EC:3.2.1.21]
Organism
pavi  Prunus avium (sweet cherry)
Pathway
pavi00460  Cyanoamino acid metabolism
pavi00500  Starch and sucrose metabolism
pavi00940  Phenylpropanoid biosynthesis
pavi01100  Metabolic pathways
pavi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    110772591
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    110772591
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    110772591
Enzymes [BR:pavi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     110772591
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 110772591
NCBI-ProteinID: XP_021832728
Position
Unknown
AA seq 221 aa AA seqDB search
YEGAAKEGGRGPSIWDTFTHKYPEKINDSSNGDITVDQYHRYKEDVGIMKNMGWDAYRFS
ISWSRLLPNGKLSGGVNKEGIKYYNNLINELLRNGLTPFVTLFHWDLPQTLEDEYGGFLS
PHIVNHFQDYAELCYKEFGDRVKHWSTVNEPYTFSNNGYALGSLAPGRCSTWQQLNCTGG
DSSTEPYLVTHHQLLAHAAAVKLYKNRYQASQNGVIGITLN
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
tatgaaggtgctgcaaaagaaggtggtagaggaccaagcatttgggataccttcactcac
aaatatccagaaaagattaacgatagcagcaatggagatatcactgttgatcaatatcac
cgctataaggaagatgtggggattatgaagaatatggggtgggatgcttatcgattctct
atctcatggtcaagattgttaccaaatggaaagttaagtggaggagtgaacaaggaagga
atcaagtattacaacaatctcatcaatgagctcttacgcaatggtttaacgccatttgtg
acactcttccattgggatcttccccaaactttagaagatgaatatggtggtttcttaagc
cctcatattgtcaatcattttcaagattacgcagaactttgttataaggaatttggtgat
cgagtaaagcattggagcacagtgaatgagccgtataccttcagtaacaatggttatgca
ctcgggtcccttgcgccgggacgatgctccacttggcagcagctaaactgcaccggcgga
gattcatctactgaaccatatttggtaacacaccaccagctccttgctcatgcagctgct
gtaaaattgtacaagaatagataccaggcatctcaaaatggagtgatagggataacactg
aat

DBGET integrated database retrieval system