KEGG   Prunus avium (sweet cherry): 110774093Help
Entry
110774093         CDS       T05161                                 

Definition
(RefSeq) N6-adenosine-methyltransferase MT-A70-like
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
pavi  Prunus avium (sweet cherry)
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pavi03019]
    110774093
Enzymes [BR:pavi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     110774093
Messenger RNA biogenesis [BR:pavi03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     110774093
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70 RPW8
Motif
Other DBs
NCBI-GeneID: 110774093
NCBI-ProteinID: XP_021834312
Position
Unknown
AA seq 813 aa AA seqDB search
MEEGIVLVRKLSNIGVWNCFAWCSCCNCTTPSYSDQLVKLNKSLRILLKRLKLQQADDVK
EVLRLNREIRDKQDDLERKVSDILKVQQEAGDVGGSSGSNTGTTIQQGKGGHQVAPLGGV
GGAAALGAVLGVLFDTVARVKDKTMMLKRPLEDVKSTLDLLKPLIEEIAVYNKGLNLPKE
ELEKVRFQMEEGVELLHKCSKVRPWTSYKRHELANKLLGLDESLQGLLNILRVHLARDVR
DRMVSVLYQIEESIMVQLQNDPTEIEDSCDVLEPPQPEVGLSVQGTRDVKETLDSAAKIE
VGVKRIKGSGDVQGQTDMGIGEPTLPTLEAPDAENKMLQSVVLYYTSSFVIIAHFYTMAV
EMALRSMAEENGGVELEEFVVSGKSRVLVLGIDRTRLMKELPESKQFQSQDSNLEDGNGN
LSQNQSQQQVVTTGVDGNGGGVFGMGGPGLPPMFPGSGPPGSLMGPRGAPSPRVMGMMGM
PRGMSGVPPMHRAGSLGPNATMDSPNSMSHKPRSEEEEMKDLEALLNKKTFKELQKSKTG
EELLDLIHRPTAKETAVAAKFKTKGGSQLKEYCTSLTKEDCRRQSNSLLACEEVHFRRII
APHMDVNLGDCSFLDTCRHMKTCKYVHYELDPTPDVSYIMMGAPALNSHKPLKPQHAEYC
SEVELGQPQWINCDICNFRMDILGQFGVIMADPPWDIHMELSYGTMADDEMRNLNVPALQ
TDGLIFLWVTGRAMELGRECLELWGYKRIEELIWFKTNQLQQIIRTGRTGHWLNHSKEHC
LVGIKGEPLVNRNIDTDVSIVEVIETSRKPDEM
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atggaggagggcatagtgcttgttaggaagctgtcaaatattggtgtgtggaattgtttt
gcatggtgcagctgctgcaactgcacaacgcctagttacagcgaccaacttgttaagttg
aataagtctcttagaatactgttaaagagactgaagctgcagcaagcagacgatgtgaag
gaggtcttgcgtttgaatagggagatccgtgacaaacaagatgatttggaaaggaaagtg
tcagatattctgaaagtgcagcaggaagcaggggatgtgggagggtcttcaggaagcaac
acaggcacgacgatacagcaagggaagggagggcatcaagtggcgccattaggcggagta
ggaggggctgccgctctaggagcagtgttaggagtgctgtttgataccgttgcgcgagtg
aaggacaagactatgatgcttaaacgccctctcgaagatgtcaaatccacgctagacttg
ttaaaaccattaatagaagaaatagcagtgtataacaagggattgaatctcccaaaggag
gaattagaaaaggttagatttcaaatggaagagggtgtggagctacttcacaagtgctcc
aaggttcgtccgtggactagctacaaaaggcatgaattagcaaacaaacttcttggattg
gatgaatcacttcaaggattgttaaatatattgagagtgcatttagcaagggatgtgaga
gatagaatggtttctgtgctctatcaaattgaagagagtattatggtacaattacagaat
gatccaactgaaattgaagattcatgtgatgtacttgaacccccacagcctgaagttgga
ttgagtgtacagggaacaagggatgtgaaggagacattagattcggcagcaaaaatagag
gtcggggtgaagcgaatcaaaggtagtggagatgtacaaggtcaaactgacatgggaata
ggtgaacctacattgcctacacttgaagctccggatgctgaaaataagatgctacagtca
gtcgtcctctattacacatcatcatttgtaattatagcacatttttacacaatggcggtg
gaaatggcgttgaggtcaatggcggaagagaatggtggcgttgagttggaggagtttgtg
gtgagtggcaagtcgagagttttggttttggggattgaccggactcggctgatgaaggaa
ttgcctgaaagcaagcagtttcagagtcaagattcgaatttggaagatgggaatgggaat
ttgagtcagaatcagagtcaacagcaagtggtgactactggggttgatggtaatggtggt
ggagtgtttggaatgggagggcccggtttgccacctatgtttcctgggagtggaccgccg
ggttcattgatgggtccaaggggtgctcctagtcctagagtaatgggcatgatgggcatg
cctagagggatgagtggtgttcctccaatgcatagagctggtagtttggggccaaatgca
acaatggatagccccaattcgatgtctcataagcctaggagtgaagaggaggaaatgaag
gatcttgaggcattgttgaataagaagacttttaaggagttgcaaaaatcaaaaactggt
gaggagcttttggacctgattcaccggccaactgctaaggagactgctgtggctgccaag
ttcaagactaaaggtggttcacaattgaaggaatactgcacatccctaacaaaagaggac
tgccggcgccagtctaattccttacttgcatgtgaggaggttcattttaggcgaataatt
gctccacatatggatgtcaatttaggagactgctcttttctggatacttgtcgtcacatg
aagacatgcaagtatgtacactatgagcttgatccaacaccagatgtgtcatacatcatg
atgggggctccagctctcaattcccataaaccattgaagcctcagcatgctgaatattgt
tctgaggttgaacttggtcaaccacaatggattaactgtgatatctgcaactttagaatg
gacattctagggcaatttggagtaataatggcagatccaccgtgggacattcatatggaa
ttgtcctatgggacaatggctgatgatgaaatgcgcaatcttaatgttcccgcgttgcag
acagatggtctgattttcctttgggtcactgggcgtgcaatggagcttgggcgtgaatgt
ttggaactttggggatacaagcgcatcgaggagctaatttggtttaagactaatcaactt
caacaaataattagaacagggcggactggccactggcttaatcatagcaaggagcattgc
cttgttggaataaaaggggaaccattagtaaatagaaatattgatactgatgtcagtatt
gtcgaggttatagagacaagccgtaagccagatgagatgtaa

DBGET integrated database retrieval system