KEGG   Pseudomonas avellanae: BKM03_03095Help
Entry
BKM03_03095       CDS       T05369                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
pavl  Pseudomonas avellanae
Brite
KEGG Orthology (KO) [BR:pavl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BKM03_03095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 Chitin_bind_4
Motif
Other DBs
NCBI-ProteinID: AVB18375
UniProt: A0A261WN32
Position
complement(615465..615845)
Genome map
AA seq 126 aa AA seqDB search
MSDSRYKVDVSVVTRFLAEQSQPEQNRFAFAYTITVHNNGELPAKLLSRHWVITDGDGHV
EEVRGEGVVGQQPLIKVGQSHTYSSGTVMTTQVGNMQGSYQMLAEDGKRFDAVIEPFRLA
VPGSLH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtccgattctcgttacaaggtcgacgtcagcgtcgtcacgcgcttcctcgcagaacaa
tcgcaacccgagcagaaccgctttgctttcgcctacaccatcaccgtgcacaacaacggc
gagttgcctgccaagctgctgtcacggcattgggtcatcaccgatggcgacggtcatgtc
gaagaagtgcgtggcgaaggggtggtcggccaacaaccgttgatcaaggtcgggcaaagc
catacctacagcagcggtacggtcatgaccacccaggtgggcaatatgcagggcagctac
cagatgctggctgaagacggcaaacgcttcgatgcggtgatagaacccttccgtcttgcc
gttccgggctcactgcactga

DBGET integrated database retrieval system