KEGG   Pseudomonas avellanae: BKM03_11955Help
Entry
BKM03_11955       CDS       T05369                                 

Definition
(GenBank) CoA transferase subunit A
  KO
K01028  3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
pavl  Pseudomonas avellanae
Pathway
pavl00072  Synthesis and degradation of ketone bodies
pavl00280  Valine, leucine and isoleucine degradation
pavl00650  Butanoate metabolism
pavl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pavl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BKM03_11955
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BKM03_11955
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BKM03_11955
Enzymes [BR:pavl01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     BKM03_11955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-ProteinID: AVB19877
UniProt: A0A261WNN5
Position
complement(2405453..2406154)
Genome map
AA seq 233 aa AA seqDB search
MAGLDKRVATYEEALAGLTDNMTVLCGGFGLCGIPENLIAQIKRMGIKGLTVVSNNCGVD
GFGLGILLEDRQIRKMISSYVGENALFEKQLLSGELQVELTPQGTLAEKLRAGGAGIPAF
YTATGYGTPVAEGKETRQFNGRNVILEEAITGDFALIKGWKADHFGNVIYRHTAQNFNPV
VATAGRITVVEVEEIVEPGVLLPTEIHTPGIYVDRVIQGTFEKRIEQRTVRKS
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggctggactcgacaaacgagtagcgacctacgaagaggccctcgccgggctgaccgac
aacatgacggtgctctgcggcggctttggcctgtgcggcatccctgaaaacctgatcgcg
cagatcaagcgcatgggcatcaagggcctgaccgtcgtttccaacaattgtggtgtcgac
ggtttcgggctgggcatcctgctggaggaccgacagatccgcaaaatgatttcgtcctat
gtcggtgaaaacgccttgttcgaaaaacagttgctcagcggcgaactgcaagtcgagctc
accccgcaaggcacgctggctgaaaaactgcgtgcaggcggcgcgggcattcctgccttc
tataccgccaccggctacggcacaccggtcgccgagggcaaggaaactcgccagttcaat
ggccgcaacgtaattctggaagaggccatcactggcgattttgcgctgatcaagggctgg
aaagccgaccatttcggcaacgtgatctatcgtcataccgcgcagaacttcaatccggta
gtcgccaccgctggacggataaccgtggtcgaggtcgaagaaatcgtcgagccgggtgta
ttgctgcctaccgagatccatacgccgggcatttatgttgaccgggtgattcagggcact
ttcgagaagcgtatcgaacagcgcaccgtcagaaaatcctga

DBGET integrated database retrieval system