KEGG   Pseudomonas avellanae: BKM03_14145Help
Entry
BKM03_14145       CDS       T05369                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pavl  Pseudomonas avellanae
Pathway
pavl00450  Selenocompound metabolism
pavl00970  Aminoacyl-tRNA biosynthesis
pavl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pavl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BKM03_14145
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BKM03_14145
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pavl01007]
    BKM03_14145
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pavl03016]
    BKM03_14145
Enzymes [BR:pavl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BKM03_14145
Amino acid related enzymes [BR:pavl01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BKM03_14145
Transfer RNA biogenesis [BR:pavl03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BKM03_14145
 Prokaryotic type
   Other AARSs
    BKM03_14145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1e tRNA-synt_1 RHH_5 tRNA-synt_1f PolC_DP2
Motif
Other DBs
NCBI-ProteinID: AVB20230
UniProt: A0A2S3T5F3
Position
2879838..2881337
Genome map
AA seq 499 aa AA seqDB search
MSKFIVTITPPTPNGDLHIGHIAGPFLAADVFTRVQRQRGHDCVLVSYSDDYQSYMLRKG
LEQGVDPVVLANRNSDRIEASLAAINIKPDNWMRPHNNPWFAEAVGEVFTALREAGAIEF
RDSSEPYCPDCAVWGYEAFARGQCNYCGAESDASQCENCAQAPDAELMSGLHCKLCQQPS
QWKTAHRAFLKLADFRPQLSDRLLGQAWRKPLDSWLRDTLEHLHDWGVTRPGDGGLDLQA
DGACRVHTWFMGLAGYMAAFREYADSIGRPELFRQYWQSGQGTLVHFLGFDCVFSHAIVY
PAQLSVLQGIKVRQRFVPNQFLKLDGLNLSTSRNHAIWVGDLARQACADSARLYLASIAP
EDSEGDFRMTQFLEWREELFNGFFPALLESAKSRGDSGWSGVCGTDAGLLEALRQQWSRA
AEPAQFSMKGLAGVLLDAIAITRARLAEGRPVSQLAAFIAVAGKALIPDMSAQLITAFGL
PEARVNATLLNGSAAEYSI
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagttcatcgtgaccatcacgccgccgacccccaacggtgacctgcacatcggc
catattgccggcccgtttctggccgccgacgtattcacccgtgtgcagcgccaacgcggt
cacgactgcgtgctggtctcctattccgacgattaccagtcctacatgctgcgcaagggg
cttgagcagggcgtcgatccggtggtgctggccaatcgcaactcggatcgcatcgaagcc
tcgctggcggcgatcaatatcaagcccgacaactggatgcgcccgcacaataacccttgg
ttcgccgaagcggtgggcgaagtgttcacggcattgcgcgaagccggtgcgatcgagttt
cgagattccagcgagccgtattgccctgattgtgctgtctggggttacgaggcgttcgcc
cgtggccagtgcaactactgtggggccgagtcggatgccagccagtgcgagaactgcgct
caggcccccgacgcagagctaatgagcggcttgcactgcaagctctgccagcagccgtcg
cagtggaaaaccgcgcaccgggcgtttctcaaactggctgatttcaggccgcagttgagt
gatcgcctgctcggtcaggcgtggcgcaagcccctcgacagctggttgcgcgacacgctg
gagcacctgcacgactggggcgtgacgcgcccgggtgacggtgggctcgacttgcaagcc
gacggcgcgtgtcgggtgcatacctggttcatgggcctggccggctacatggctgcgttt
cgtgagtacgccgacagcatcggccgccccgagctgtttcgtcagtactggcagtcgggg
caaggcacgctggtgcactttctcggttttgactgcgtgttcagccacgccatcgtctac
ccggcgcaattgtcggtgctgcagggcatcaaggtccgccagcgtttcgtgcccaatcag
tttctcaaacttgatggcctgaatctgtcgaccagccgcaaccacgcgatctgggttggc
gacctggcccgtcaggcctgcgccgacagcgcgcgcctgtacctggcgagcattgcgcct
gaggacagcgagggcgattttcgaatgacgcagttccttgaatggcgggaagagctgttc
aacggcttttttcccgccttgctggagtctgcaaaaagtcgaggcgacagcgggtggagc
ggcgtctgcgggacggatgccggtttgctggaagccttgcgtcagcaatggagccgcgcc
gcagagcctgcgcaattctccatgaaaggcttggccggtgtgctgctggatgcaattgcg
atcacccgcgcacgtttggccgaaggccgccctgtcagtcaactggcggcgttcatcgcg
gtggccggcaaagcgctgattccggatatgtccgcgcagctcatcaccgcattcgggctg
cccgaagcgcgggtcaacgccacgctcctgaacggctctgccgctgaatactccatctga

DBGET integrated database retrieval system