KEGG   Pseudomonas avellanae: BKM03_26940Help
Entry
BKM03_26940       CDS       T05369                                 

Definition
(GenBank) amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
pavl  Pseudomonas avellanae
Pathway
pavl00330  Arginine and proline metabolism
pavl00360  Phenylalanine metabolism
pavl00380  Tryptophan metabolism
pavl00627  Aminobenzoate degradation
pavl00643  Styrene degradation
pavl01100  Metabolic pathways
pavl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pavl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BKM03_26940
   00360 Phenylalanine metabolism
    BKM03_26940
   00380 Tryptophan metabolism
    BKM03_26940
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BKM03_26940
   00643 Styrene degradation
    BKM03_26940
Enzymes [BR:pavl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     BKM03_26940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AVB22436
UniProt: A0A2S3TFS8
Position
complement(5632887..5634407)
Genome map
AA seq 506 aa AA seqDB search
MNNQFGLDLAVSIAQLASADQVHASFDGPVFGSIIENKAVYFESSVELQQRMSAGSLTSV
ELVQDLLQRIEALNNNGPQLNAVIEVNPDALQIAAQMDAERSRGEKRGPLHGIPVLVKDN
INTGDKMQTTAGALAMVGSPAPHDAFVVKRLREAGAIIIGKANLSEWAFFRGENPPSGWS
GRGGQTLHSYNLSVDPRGSSTGSAVGLAAGFSPLALGTETNGSIIQPAQTNGVVGLRPTL
GLLSRTGMIPLTRRQDTPGPMARTVTDTAIMLTAMSGTDPLDDATGQASTYTVNYFDHLS
TDALRGKRLGYPRLTWDDKSMDDDPDFQKAKISLQSAGAIVVPIDVPDIDNSPEFDVMLQ
DFKRELNAYLSTRPGLEVSTLDDIIAFNTASPSAEGYDQNLLIQSSNTPVDPDNLSKATD
LRNANQQLIDGLVQQQSLDALVDLSYVSFKGVGAVAGYPGITVPFMRHDDGMPEGLYFLS
TAWDEANLLSYAYALEQALVAAPQED
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatcagtttggtttggatcttgcagtctcgattgcgcagttagcatctgctgat
caggtgcacgcaagctttgacggacccgttttcggttcgatcatcgaaaacaaagccgtt
tattttgaatccagtgttgagcttcagcaacgcatgagcgcaggcagcctgacttctgtc
gagctggttcaagacctgctccagcgtattgaagcgctgaacaacaatggcccacagctt
aacgctgtcattgaagtcaaccccgacgctctgcagatcgccgcgcaaatggacgcggag
cgttcccgcggcgaaaaacgtgggccgctgcacggcattcccgtgctagtgaaagacaac
atcaatacgggcgacaagatgcagacgactgcgggcgctctcgcgatggtcgggtcgcct
gctccgcacgatgcttttgtggtgaagcggcttcgcgaggccggcgcgatcattatcggc
aaggccaatctcagcgaatgggctttttttcgtggagagaatccaccgagcggttggagc
ggccgaggcgggcagacgcttcattcctataacctaagcgttgatccgcgcggctccagt
accggttcggcagtgggtcttgccgctggtttttcgcctctggcattgggcaccgagact
aacggttcgatcattcaacctgcgcaaacgaatggtgtcgtagggctaaggcctacgctg
ggtctgctcagccgcaccggtatgattccgctcacccgtcgtcaggacacccccggtccc
atggcgcgaaccgtcactgataccgccatcatgctgacggccatgagcggcacagaccct
ctcgacgacgccaccggccaagcttccacctacaccgtgaactacttcgatcacctcagc
acggacgcgttaagaggcaaacgcctgggctatccgaggttgacgtgggacgacaagtca
atggacgatgatcctgatttccaaaaggcaaagatcagtttgcagtctgccggggcgata
gtggtccccatcgacgttccggatattgataacagtccagagtttgacgtgatgctgcag
gatttcaagcgtgagctaaatgcttacttgagcacgcgccctgggcttgaggtgagcacg
ctggatgacatcattgcgttcaacaccgcatctccttcggcagaaggctatgaccagaat
ctattgattcagtcttctaacacgcctgtcgatccggataacctgtccaaggcaaccgat
ttgcgcaatgctaatcagcaactgatagatgggcttgtgcaacaacaatcgcttgacgca
ctcgttgacttgtcatacgtctccttcaaaggggttggcgctgtcgcgggttatccggga
ataaccgtgcctttcatgcgccatgatgatggcatgccagaagggctgtattttctttcc
acggcctgggatgaagctaatttgctgagctatgcctacgcacttgaacaggctcttgtg
gctgcacctcaggaagattga

DBGET integrated database retrieval system