KEGG   Cutibacterium acnes 266: PAZ_c08560Help
Entry
PAZ_c08560        CDS       T01971                                 

Definition
(GenBank) putative phosphoglycerate mutase/fructose-2,6-bisphosphatase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
paw  Cutibacterium acnes 266
Pathway
paw00010  Glycolysis / Gluconeogenesis
paw00260  Glycine, serine and threonine metabolism
paw00680  Methane metabolism
paw01100  Metabolic pathways
paw01110  Biosynthesis of secondary metabolites
paw01120  Microbial metabolism in diverse environments
paw01130  Biosynthesis of antibiotics
paw01200  Carbon metabolism
paw01230  Biosynthesis of amino acids
Module
paw_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
paw_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:paw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAZ_c08560
  Energy metabolism
   00680 Methane metabolism
    PAZ_c08560
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PAZ_c08560
Enzymes [BR:paw01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PAZ_c08560
Membrane trafficking [BR:paw04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    PAZ_c08560
Exosome [BR:paw04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PAZ_c08560
  Exosomal proteins of melanoma cells
   PAZ_c08560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEE72036
Position
complement(879960..880706)
Genome map
AA seq 248 aa AA seqDB search
MHLLLIRHGQSENNAFAAQSVETYQQGRKPDPELTELGRRQAQALGKWIGSVSPRPTKLY
ASPMMRTIQTADPVAEALDLPIIINDLIFERPGPVQIVDGVETGHPGSPRSALSAITDRA
VFPESITEEGWREARIETAAEAADRAGRIAKWIRDTHNDDECIAIVAHGAIGSMMLLHLI
APQLAAGLRNHSIGSEPHWIGLQNTATSMIELHPDGYEVHWINRVDHLIEAGMVHGAVAA
STGNPGTR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtgcatcttctcctcatccgccacggccagtccgagaacaatgccttcgctgcgcagtct
gtcgagacttaccagcagggtcgcaagcctgacccggagctcaccgagcttggacgacgt
caagctcaggccctagggaagtggatcggatcggtctctcctcggccaacgaagctgtat
gcctcccccatgatgcgtaccatccagacggctgacccggtcgctgaggcccttgatctt
cctatcatcatcaatgacctcatcttcgagcgtccaggtccagttcagatcgttgacggc
gtcgaaaccggtcatccaggatcgccgcgatcagctttgtcggccatcacagaccgtgct
gttttccccgagtccatcaccgaggaagggtggcgcgaagctcgcatcgagaccgccgcc
gaggctgctgaccgcgccggcagaatcgccaagtggatccgcgatacccacaatgatgac
gagtgcatcgcgatcgtcgctcacggcgcgatcggatccatgatgttgctgcatctcatc
gccccacaacttgccgctggtctgcgaaaccactccatcggcagcgaaccgcactggatc
gggcttcagaacaccgccacctcgatgatcgagttgcacccggacgggtacgaagttcat
tggatcaatcgcgtggatcaccttatcgaagccggtatggttcacggcgccgtcgccgca
tccaccggcaaccccggtacccgctga

DBGET integrated database retrieval system