KEGG   Cutibacterium acnes 266: PAZ_c08640Help
Entry
PAZ_c08640        CDS       T01971                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
paw  Cutibacterium acnes 266
Pathway
paw00010  Glycolysis / Gluconeogenesis
paw00051  Fructose and mannose metabolism
paw00562  Inositol phosphate metabolism
paw01100  Metabolic pathways
paw01110  Biosynthesis of secondary metabolites
paw01120  Microbial metabolism in diverse environments
paw01130  Biosynthesis of antibiotics
paw01200  Carbon metabolism
paw01230  Biosynthesis of amino acids
Module
paw_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
paw_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:paw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAZ_c08640 (tpiA)
   00051 Fructose and mannose metabolism
    PAZ_c08640 (tpiA)
   00562 Inositol phosphate metabolism
    PAZ_c08640 (tpiA)
Enzymes [BR:paw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PAZ_c08640 (tpiA)
Exosome [BR:paw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PAZ_c08640 (tpiA)
  Exosomal proteins of bladder cancer cells
   PAZ_c08640 (tpiA)
  Exosomal proteins of melanoma cells
   PAZ_c08640 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEE72044
Position
890220..890999
Genome map
AA seq 259 aa AA seqDB search
MSRTPIMAGNWKMNLDHVAATSLVQDLGEALKAAGYDSSKSEAVVIPPFTDIRPVAIIID
GDKLPIAYGAQDISAHDDGAYTGEVSGAMLSKLGCRYVVVGHSERREYHNESDELVNAKA
KKVIENGMTPIICCGEALEVRKAGKHVEHTVGQIKADLDGISAEQVAKLVIAYEPIWAIG
TGETATADDAQEVCQAIREAVKELYDAPTAEAVRIQYGGSVKPANVAEIMAKPDVDGALV
GGASLKAGDFSKIVTFYEA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtaccccgatcatggccggcaactggaagatgaacctcgaccacgttgctgct
acctccctcgtccaggatctcggtgaggccctcaaggccgcgggatacgactcctccaag
tcggaggccgtcgtcatcccgccgttcaccgatatccgtcctgttgccatcatcattgat
ggcgacaagttgccgatcgcctacggtgcccaggatatttcggctcacgacgatggcgct
tacaccggcgaggtgtccggcgccatgctgtcgaagctgggttgccgctatgtcgtcgtt
ggccactccgagcgtcgcgagtaccacaacgagtccgacgaactggtcaatgccaaggct
aagaaggtcatcgaaaatggaatgaccccaatcatctgctgtggcgaggccctcgaggtt
cgcaaggctggcaagcacgtcgaacataccgttggccagatcaaagccgaccttgacggc
atttctgccgagcaggtcgccaagcttgtcattgcctacgagcccatctgggccatcggc
actggcgagactgccaccgctgacgatgcccaggaggtctgccaggccatccgcgaggcc
gtcaaggagctttacgacgccccgaccgccgaggcggtgcgcattcagtacggtggttca
gttaaaccggccaacgtcgctgagatcatggccaagccagacgttgacggcgctctcgtt
ggcggagcctcgctcaaagctggcgatttctccaagattgtaactttctacgaggcctga

DBGET integrated database retrieval system