KEGG   Cutibacterium acnes 266: PAZ_c08800Help
Entry
PAZ_c08800        CDS       T01971                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
paw  Cutibacterium acnes 266
Pathway
paw00330  Arginine and proline metabolism
paw00332  Carbapenem biosynthesis
paw01100  Metabolic pathways
paw01130  Biosynthesis of antibiotics
paw01230  Biosynthesis of amino acids
Module
paw_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:paw00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PAZ_c08800 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    PAZ_c08800 (proB)
Enzymes [BR:paw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     PAZ_c08800 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AEE72060
Position
905538..906713
Genome map
AA seq 391 aa AA seqDB search
MTDQRGAICGAATLVVKVGSSSLTLPGGGIDVRRVDDLVDALSEVIAVGRRVVLVSSGAI
ATGFPAMGITHRPRTLAGKQAAASVGQGILLAHYASRFASHGLRVGQVLLTVNDLVRPTS
YRNAWSTLDTLLGLGVVPIVNENDTVATGEIRFGDNDRLAALVAELVGAQALILLSDVDA
LYTAHPDSPDARRVEVVEDIDTLDVDTHKAGSGVGTGGMTTKLEAARMATCAGVPVVLAA
AVDAPDVLAGAPVGTYFRPLATRRPRRLLWLADAATPQGQIVIDDGAVEALTQRHSSLLA
VGVTRVHGDFQAGDPVTILASDGRVVGRGIAQFSHDEVRVMRGRSSAWLAAEMGPAASRE
IIHRDAMVLSRRRKAEPSSRNQKSSGSRVTS
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
gtgactgatcagcgtggagccatatgcggggccgccaccctggtggtcaaggtcggatct
tcctctttgactcttcctggtggcgggattgacgttcgtcgtgttgacgacctggttgat
gcgctgagtgaggtcatcgcggtcggccggcgtgtcgtcctggtgagttccggggcgatt
gccaccggatttcccgccatggggataactcatcgtccgcgcactttggctggcaagcaa
gcggccgcgtcggtgggacaaggtattttactggctcactacgcgtcgaggtttgccagt
cacgggttgcgggtggggcaggtactactcaccgtcaatgacctggtgcggcccacctcg
taccgcaatgcctggtcaaccctcgacactttgctggggttgggcgtcgtgccgatcgtc
aacgagaacgacacggtcgccaccggagaaattcggtttggcgataatgatcggcttgct
gccctggtagccgagctggtgggcgctcaagccctcatcctgctctctgacgttgacgcc
ttgtacaccgcccatccggattcaccggatgctcgtcgcgtggaggttgtggaggacatc
gacacattggatgtcgatacccataaagctggttcgggggtgggaaccggcggcatgacc
acgaaacttgaagccgcccgaatggccacctgtgccggggtaccggtggtactcgcagcg
gcggtggatgccccggacgttctggctggtgcccccgtgggtacctacttccgcccgctg
gcgacgcgacggccccgacggttgctgtggttggccgacgctgccaccccgcagggacag
atcgtcatcgacgacggagctgtcgaagctttgacacagcgtcattcctcgttgttggcg
gtgggtgtgactcgggtacacggggatttccaagcaggcgacccagtgacgatcctggcc
tccgacggtcgagttgttggtcgcggtatcgcccagttctcccatgatgaggtgcgcgtc
atgaggggacgttcgagtgcctggctggccgcagaaatgggcccggcggcctctcgcgag
atcatccaccgcgatgccatggtgctgagtcgtcgtcgtaaagctgagccgtcgtcgagg
aaccagaaaagtagcgggtcaagggtgacgtcctga

DBGET integrated database retrieval system