KEGG   Cutibacterium acnes 266: PAZ_c11940Help
Entry
PAZ_c11940        CDS       T01971                                 

Gene name
bglH
Definition
(GenBank) aryl-phospho-beta-D-glucosidase BglH
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
paw  Cutibacterium acnes 266
Pathway
paw00010  Glycolysis / Gluconeogenesis
paw00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:paw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAZ_c11940 (bglH)
   00500 Starch and sucrose metabolism
    PAZ_c11940 (bglH)
Enzymes [BR:paw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     PAZ_c11940 (bglH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase Glyco_hydro_42
Motif
Other DBs
NCBI-ProteinID: AEE72364
Position
1221115..1222545
Genome map
AA seq 476 aa AA seqDB search
MKRILWGGATAASQYEGGFYDGKGMDTQDCRRWIPRLSNDTIQTRLLTEADIRNAKNSRS
DDCRFPFRMGSRGYEYWESDLHYITSLGLDVYRLSISWARLFPTGFEDQPNPEGVMYYDR
IIRTLAHAGIKVFITINHYAMPIAIVDKYGGWRHRDVIDLYLKMAKFVVDRWQENVDYWL
PVNEINSGYFSPYNGLGIIGTIDYSYDYRSIFNGLHYQMIASALITKYGRDIGARGKFVC
MVSCFDYYALHPTPEDNMKLVHDEQINQWWCADVLATGEYGYYTEKFLADHGVVLDITDK
DRGILRSNTCDIVSFSYYSSSICSVDEKREQVPGNLVPTLRNASLEATEWGWQIDPMGLR
ITAHKVYDRYRKPIMVAENGLGARDNVDSDGRIHDNYRISYLERHMEQAELAVREGVDIE
AYFVWGIIDIVSAGSCEMEKRYGVVYVDADNEGRGTYKRLPKDSFYWYRDFIASHR
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcattctgtggggtggggctaccgcggccagtcaatatgaaggcgggttctac
gacggaaagggaatggacacccaagactgtcgtcgatggattccgcggctatcgaatgat
acgatacaaactcgtctcctcaccgaggctgatattcgaaacgcaaagaattctcgttct
gacgactgccggttcccgttccgtatgggatcgcggggttacgaatactgggaatcagac
ttacactacattaccagtcttggcctagatgtatatcgtctttcgattagctgggcccgt
ctatttcccactggtttcgaggaccagcccaatccggaaggggtgatgtactatgaccgg
attattcgcacccttgcacatgctggaattaaagtcttcatcacgatcaatcactatgcg
atgccgattgcgatcgttgacaagtacggaggttggcgacatcgtgacgtcatcgatctg
tatcttaagatggcgaaatttgtcgtcgatcgctggcaagaaaatgtagactattggctt
cctgtaaacgagattaattccgggtatttcagtccttataatggactcggaataatagga
accatcgattactcctatgattatcggtcaatctttaatggtcttcattaccaaatgata
gcaagcgccctcataacaaaatacggtcgcgatatcggagcacgaggaaagttcgtgtgc
atggtgagctgtttcgattactatgcgctccatcccacacctgaggacaacatgaagctc
gttcacgacgagcagatcaatcagtggtggtgtgcagatgtactagcaacaggtgaatac
gggtattacacagagaagttcttggccgaccatggggtagtactcgacatcacggacaag
gaccgtggcatactcaggtcgaatacctgtgacatcgtgtcattttcgtactattcatcg
tcgatttgtagtgtagacgaaaaacgtgaacaagtccctggaaacctggtaccaacattg
agaaacgctagtttggaagctaccgagtggggatggcagatagaccccatgggtttgagg
attacggctcacaaggtttacgaccggtaccggaagcccataatggttgctgagaatgga
ttgggtgcgcgggataatgtcgactctgatgggcgtatccacgataattatagaatatca
tatctcgagcgccatatggaacaggctgagcttgccgtgcgggagggtgtagatatagaa
gcatatttcgtttggggcatcattgacatcgtcagtgccggtagttgcgaaatggagaaa
aggtacggtgtcgtctatgtcgacgcagacaacgaagggcggggaacttataaacggttg
ccgaaagatagtttctattggtatcgcgacttcatcgcctctcataggtga

DBGET integrated database retrieval system