KEGG   Cutibacterium acnes 266: PAZ_c12010Help
Entry
PAZ_c12010        CDS       T01971                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
paw  Cutibacterium acnes 266
Pathway
paw00340  Histidine metabolism
paw01100  Metabolic pathways
paw01110  Biosynthesis of secondary metabolites
paw01230  Biosynthesis of amino acids
Module
paw_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:paw00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    PAZ_c12010 (hisD)
Enzymes [BR:paw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     PAZ_c12010 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh POTRA_3
Motif
Other DBs
NCBI-ProteinID: AEE72371
Position
1229613..1230932
Genome map
AA seq 439 aa AA seqDB search
MLRIVDVTSETTDDLRCAVPRADFDVDAAMAAVIPVCSAVRDRGVEALREYSEKFDHVVP
EHLRVPVEALATAAANLDGTLRRAFSESIRRRRHVCQEAEVEASSQPVEVAGGARVSQRI
VPVGRVGLYVPGGFAPLASSVIMNVVPAQEAGVSSIAVASPPQAEFGGLPHPSILALCHL
LGVNEVYAVGGAQAIAMFAYGVEGSDEADSCPRVDMVTGPGNIYVVAAKRCLRGTVGIDS
EAGPTEIAILADKTADPRHIAADLMSQAEHDTLAAAVLVTDSTTLAEAVQRELAPMVSAT
LHSERIRTSLTSKQSAIVMVRDIDQGLEVVNAYAAEHLEIQTADAAAVAARVRNAGAIFV
GPWAPVSLGDYSAGSTHVLPTAGAACHSSGLSVRSFMRAVHVIDYTEDALLELADSVEAF
ALAENLPGHANAITVRRSR
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
gtgctgagaatcgtcgatgtgaccagtgagaccactgacgacctgcgttgcgccgtgcct
cgcgcggacttcgatgtcgatgccgccatggcggccgtcatccccgtctgctctgcggtg
agggatcgtggcgttgaggcgctacgtgagtacagcgagaaattcgaccatgtggttccc
gagcatctgcgcgttccggtcgaggctctcgccacggcagctgcgaacctcgacggcacc
ttgcgtcgggctttcagcgaatctattcgacgtcgtcgtcacgtatgtcaggaagctgag
gtggaggcctcttcccaaccggttgaggtggcaggcggcgcgcgggtgagccagcgcatc
gtcccggtcgggcgtgtaggcctttacgttccgggtgggttcgctccgctggcatcgtcg
gtcatcatgaacgtcgttcctgcgcaggaggccggtgtttcgtctatcgctgtagcatct
ccgccccaggcggagtttggtgggttgccgcacccgagcatcttggcgctgtgtcatcta
ctgggtgtcaatgaggtctacgccgtcggcggtgcccaggcgatcgccatgttcgcttac
ggcgttgagggctccgacgaggcagattcctgtccgcgcgtcgacatggttacgggtcca
ggcaacatctacgtagtcgcggcaaagcgctgcctgcgtggcaccgtcggcatcgattcg
gaggctgggcccaccgaaatcgccatcctggccgataagactgccgacccgcgtcacatt
gctgctgatcttatgagccaggctgagcatgacacgctggctgccgcagtgcttgtcaca
gactcgaccacactggccgaagctgtgcaacgagaacttgccccgatggtcagtgccacg
ttacattccgagcgcattcgcacctcgctgacatccaagcagtcggccatcgtcatggta
cgtgatattgatcagggcctcgaagtggtcaatgcgtatgccgccgagcatctcgagatc
cagacggctgatgctgccgcagtcgctgctcgggtccggaacgctggcgccattttcgtc
ggcccgtgggcgcctgtctctcttggggactactcagccggatccactcacgtccttccc
acggcaggagcagcctgccactcgtctggtctgtcggtgcgttccttcatgcgcgccgtc
cacgtcatcgattacaccgaggatgccctacttgagctggccgattccgttgaggctttt
gccttggcggagaacttgcccggccatgccaatgccatcactgtgaggaggtcacgttga

DBGET integrated database retrieval system