KEGG   Cutibacterium acnes 266: PAZ_c18000Help
Entry
PAZ_c18000        CDS       T01971                                 

Gene name
metG
Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
paw  Cutibacterium acnes 266
Pathway
paw00450  Selenocompound metabolism
paw00970  Aminoacyl-tRNA biosynthesis
paw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    PAZ_c18000 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PAZ_c18000 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:paw01007]
    PAZ_c18000 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:paw03016]
    PAZ_c18000 (metG)
Enzymes [BR:paw01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     PAZ_c18000 (metG)
Amino acid related enzymes [BR:paw01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   PAZ_c18000 (metG)
Transfer RNA biogenesis [BR:paw03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    PAZ_c18000 (metG)
 Prokaryotic type
   Other AARSs
    PAZ_c18000 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AEE72941
Position
complement(1836119..1837924)
Genome map
AA seq 601 aa AA seqDB search
MPATDRVNLMCANVLAAVAWPYANGPRHIGHVSGFGVPSDVFARYMRMSGHRVLMVSGSD
CHGTAISVKADQEGVTAQECAEKYHRIIAAGLQGLGLSYDLYTSTLTDNHADVTQEIFTR
LHENGYVVKRSEMGAFEPSTGRTLPDRYIEGTCPVCGYDDARGDQCDNCGRQLDPADLID
PRSKTTGAAPEFRETEHFFLDLPALAESLASWIDTRTDWRPNVLKFSHNLLEELRPRAIT
RDLDWGIRVPVEGWQDNPMKSIYVWFDAVIGYLSASIEWARRIGRPDAWREFWNDEDARS
YYFMGKDNIVFHSVIWPGILLGTNGRGDKGGEPSEELGTLNLPTEIVSSEFLTMSGSKVS
NSRGATIFVGDFLHEFGPDALRYFIAVAGPENQDTDFTWEEFVRRVNFELANEWGNLVNR
SISMAFKNCHEIPAAGELTDADRELLDAAATGFDTVGGLLAHARFKAAITEAMRIVGLAN
AYISAEEPWKLKDNPERRDTVLHVALQVVSDVNTMMTPFMPHSAQKIYEALGGEGVWAAQ
PELIETDGAPILMGDYATEQASWGRHEIAVGTPLSKPSPIFRKLDAKLAQTGPQWAPVNP
Q
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgccggctaccgatagagttaacctcatgtgtgccaacgttcttgccgccgtcgcgtgg
ccttacgctaatgggcctcgacatatcggccatgtttccggattcggtgtcccctctgac
gtctttgcccggtacatgcgaatgtcgggtcaccgagtcctcatggtttccggctcggat
tgtcatggcaccgctatttcagtcaaggctgatcaggagggcgtgacggctcaagagtgc
gctgagaagtatcaccgcatcatcgcggcaggcttgcaggggctcgggttgtcctacgat
ctgtacacgtcgacgctgaccgacaaccacgctgacgtcacccaggagatctttactcgc
ctccacgaaaacggctacgtcgtcaagaggtccgagatgggggcgttcgagccatcgacc
ggacgtacccttccggaccgttacattgagggcacctgtccggtgtgtggatacgacgat
gcccgcggtgaccagtgcgataactgtggccgtcagctcgacccggccgaccttatcgac
cccagatcaaagaccacaggggccgctcccgagtttcgcgagaccgagcacttctttctc
gaccttcctgccctggccgagtcgttggcgtcgtggattgacactcgcaccgattggcgt
cccaatgtcttgaagttttcccacaacctgcttgaggagttgcgtccgcgcgctattacc
cgcgatctcgactggggcattcgcgtgccagtagaaggctggcaggacaacccgatgaag
tcgatctacgtgtggttcgacgctgtcatcggatacctgtctgcctcgattgagtgggcg
cgccgtattggtaggcctgatgcgtggcgtgagttctggaatgacgaggatgcccgttcg
tactacttcatgggtaaggacaacattgtgttccactcggttatttggcccggcatcctg
ctgggtacaaatggacgtggtgataagggtggcgagccatccgaggaacttggaaccctt
aaccttcccaccgagattgtttccagcgagtttctgacgatgagtggttcaaaggtgtcg
aactctcgtggcgccaccatttttgtcggagacttcctccatgagttcggccccgacgcc
ctgcgctacttcatcgcggttgccggtccggagaatcaggacactgatttcacctgggaa
gagtttgtccgccgggtgaattttgagctcgccaacgagtggggcaacctcgttaacagg
tcgatttcgatggcgttcaagaattgccacgagattccggctgctggtgagctgacagac
gctgaccgtgagttgctggatgccgctgctactgggtttgacaccgtgggcgggttgctt
gcccacgccagattcaaggctgccattactgaggcgatgaggatcgttgggctagctaat
gcctatatctctgctgaggaaccctggaaactcaaggacaaccctgagcgccgtgacacc
gtgctgcatgtggctttgcaggtcgtgagtgacgttaacaccatgatgaccccgttcatg
cctcattcggcgcagaagatttatgaggcccttggtggcgagggtgtgtgggcggcccag
cctgagctcattgagaccgatggggcaccgatcctcatgggggattacgccaccgagcag
gcgtcatggggccgtcatgaaatcgcggtaggtactccgctgtccaaaccttcgcccatc
ttccggaagcttgacgctaagctcgcccagaccggtccgcaatgggccccggtcaacccg
cagtaa

DBGET integrated database retrieval system