KEGG   Cutibacterium acnes 266: PAZ_c18290Help
Entry
PAZ_c18290        CDS       T01971                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA ligase [ADP-forming] subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
paw  Cutibacterium acnes 266
Pathway
paw00020  Citrate cycle (TCA cycle)
paw00640  Propanoate metabolism
paw00660  C5-Branched dibasic acid metabolism
paw01100  Metabolic pathways
paw01110  Biosynthesis of secondary metabolites
paw01120  Microbial metabolism in diverse environments
paw01130  Biosynthesis of antibiotics
paw01200  Carbon metabolism
Module
paw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:paw00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PAZ_c18290 (sucC)
   00640 Propanoate metabolism
    PAZ_c18290 (sucC)
   00660 C5-Branched dibasic acid metabolism
    PAZ_c18290 (sucC)
Enzymes [BR:paw01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PAZ_c18290 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A SBP_bac_5
Motif
Other DBs
NCBI-ProteinID: AEE72970
Position
complement(1869176..1870303)
Genome map
AA seq 375 aa AA seqDB search
MPVLRGIVAETPEQASEAAAKLGTPVVAVKAQVKVGGRGKAGGVKIAKSPAEAAERAEAI
LGMDIKGHTVHKVMVAEGADIAEEYYFSILLDRGERRYLAMCSREGGMDIETLAKERPEA
LAKVPVDPIDGVDDAKAREILSEAGFPDSEQDAIVPAVLKLWETYRDEDATLVEVNPMIK
TGDGRILAIDGKMTVDNNASFRQPDHAGLVDRATTDPLELRAGELGLNYVKLDGNVGVIG
NGAGLVMSTLDCVAYAGENFPGSPAPANFLDIGGGASAEIMANGLDLIMSDEQVRSVFVN
VFGGITACDQVALGIKGALEKLGDKAVKPLVVRLDGNAVAEGRKILEEFNHPLVTMVSTM
DEAASKAAELASKEA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgtacttcgaggcatcgtcgcggagactccagagcaggcgtccgaggctgcagcg
aagctcggtacccccgtcgtcgccgtcaaggcgcaggtcaaagtgggtggccgtggcaag
gctggcggtgtaaagatcgctaagtccccggccgaggcggctgaacgcgccgaggccatc
ctcggtatggacatcaagggtcacaccgttcacaaggtgatggtcgctgaaggtgctgac
attgccgaggaatactacttctcgatcttgctcgaccgtggagagcgtcgctaccttgcg
atgtgctcgcgtgagggtggcatggacatcgagacccttgctaaggagcgccccgaggct
ctcgccaaggtgccggtcgacccgattgacggcgttgacgatgctaaagcccgcgagatc
cttagcgaggcagggttccccgactctgagcaggacgctatcgtcccggctgttctcaag
ctgtgggagacctaccgtgacgaggatgccaccctcgtcgaagtcaacccgatgatcaag
accggcgatggacgcatcctggctatcgacggcaagatgactgttgacaacaacgcgtcc
ttccgtcagcctgaccatgccggcctggtggatcgcgccaccaccgacccgctcgagttg
cgtgccggcgagctcggtctcaactacgtcaagctcgacggcaacgtcggcgtcatcgga
aacggtgctggactggttatgagcacccttgactgcgttgcttacgccggtgagaacttc
ccgggatctccggctcccgctaacttcctcgacatcggtggcggcgcctcggccgagatc
atggccaacggccttgacctcatcatgagtgacgagcaggtgcgttccgtgttcgtcaac
gtctttggcggtatcaccgcctgtgaccaggtggcgcttggtatcaagggcgctctcgag
aagttgggcgacaaggccgtgaagccgctcgtcgtccgtctggacggcaacgctgtggcc
gagggccgcaagattctcgaggaattcaaccacccgctcgtgaccatggtctcgaccatg
gacgaggccgccagcaaggccgccgagctcgcatccaaggaggcctga

DBGET integrated database retrieval system