KEGG   Cutibacterium acnes 266: PAZ_c19330Help
Entry
PAZ_c19330        CDS       T01971                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
paw  Cutibacterium acnes 266
Pathway
paw03010  Ribosome
Brite
KEGG Orthology (KO) [BR:paw00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    PAZ_c19330 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:paw03011]
    PAZ_c19330 (rplV)
Ribosome [BR:paw03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    PAZ_c19330 (rplV)
  Bacteria
    PAZ_c19330 (rplV)
  Archaea
    PAZ_c19330 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AEE73069
Position
complement(1961727..1962188)
Genome map
AA seq 153 aa AA seqDB search
MSKTERPSRRAALLGDRPGSYAIARHVRMSASKCRRVINLVRGMDAVDAVTMLKFQPQAA
AEPIRKVIASAMANAEQTEGLRADDLYISQAFVDEGITMRRIRPRAKGSASRILKRSAHI
TVVVEPKEARQARKKAKSGRPAAAAKSETEKGA
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaactgagaggcccagccgtcgcgccgccctgctcggcgatcgacccggctcg
tacgctattgcgcgtcacgtccggatgagcgccagcaagtgccgtcgtgttatcaacctg
gttcgcggtatggacgccgttgatgcagtgaccatgctgaagttccagccgcaggccgcg
gccgagccgattcgcaaggttattgcctcagccatggccaacgccgagcagaccgagggc
ctgcgtgccgacgacctgtacatttcgcaggcctttgtcgacgagggcatcaccatgcgc
cgcatccgtcctcgcgccaagggatccgctagccggattctgaagcgctccgctcacatc
accgtggttgttgagcccaaggaagcccgtcaggcccgtaagaaggccaagtcgggacgt
ccagcagctgcagccaagtccgagaccgagaagggagcctga

DBGET integrated database retrieval system