KEGG   Cutibacterium acnes 266: PAZ_c21400Help
Entry
PAZ_c21400        CDS       T01971                                 

Gene name
cat2
Definition
(GenBank) succinyl-CoA:coenzyme A transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
paw  Cutibacterium acnes 266
Pathway
paw00020  Citrate cycle (TCA cycle)
paw00620  Pyruvate metabolism
paw00650  Butanoate metabolism
paw01100  Metabolic pathways
paw01110  Biosynthesis of secondary metabolites
paw01120  Microbial metabolism in diverse environments
paw01130  Biosynthesis of antibiotics
paw01200  Carbon metabolism
Module
paw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:paw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PAZ_c21400 (cat2)
   00620 Pyruvate metabolism
    PAZ_c21400 (cat2)
   00650 Butanoate metabolism
    PAZ_c21400 (cat2)
Enzymes [BR:paw01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     PAZ_c21400 (cat2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans
Motif
Other DBs
NCBI-ProteinID: AEE73264
Position
2182149..2183663
Genome map
AA seq 504 aa AA seqDB search
MSERIANAALRQKVMSADDAAALIHDGDQIGFGGFTGSGYPKELPGALTKRIQESHGRGE
KFTVNVFTGASTAPELDGALASVDGIGWRMPYQSDPQMRSKINDGTSFYTDIHLSESGMM
VRQGFFGKVDFAVIEATRITADGDVVLTSSVGNNAVYCDTAEKVIIEVNSWQSEDLEGMH
DIYGGFALPPNRVPIPITHPGDRIGDKFLHIPQNKIVAIIETAGPDRNTPFKPIDDDSRK
IAGFLLDFYDNEVKQGRIPKNLLPLQSGVGNIPNAVLDGLLHSDLEHLTSYTEVIQDGMI
DLIDAGKLDVASATAFSLSPDYAHKMNENAAFYRDHIILRPQEISNHPEVIRRLGVIGAN
GMIEADIYGNVNSTHVMGSRMMNGIGGSGDFTRNAYISAFVSPSTAKGGAISAIVPMVSH
VDHTEHDGMVIITEQGIADLRGLAPRQRAPKIIENCAHPDYRPMLLDYYERALRDCKFKH
TPHLLGEAYSWHTRFLETGTMKKD
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagcggattgccaacgcagccctgcgtcagaaagtgatgagcgcggacgacgcg
gctgccctcatccatgacggcgaccagatcggattcggtggattcactgggtcgggctac
cccaaggaacttccaggcgcactgaccaagcgcatccaagagtcccacggccgtggtgag
aagttcaccgtcaacgtcttcaccggagcctcgaccgctcctgaactcgacggcgccctc
gcctctgtcgacggcatcggctggcgtatgccgtaccagtccgatccccagatgcgaagc
aagatcaacgacggcacctccttctataccgacatccatctgtcggagtcgggcatgatg
gtgcgtcagggcttcttcggcaaggtcgacttcgccgtcatcgaggccacacgaatcacc
gcggacggggatgtcgtcctcacctcgtcggttggcaacaacgcggtctactgtgacacc
gccgagaaagtcatcatcgaggtaaattcgtggcagtccgaggacctcgaaggaatgcac
gacatctacggtggttttgcgcttcctccgaaccgggtgccgatcccgattacccatccc
ggtgaccggatcggtgacaagttcctccacatcccccagaacaagattgtggcgatcatc
gagaccgcaggccccgaccgcaacaccccgttcaagccgatcgacgacgactctcgcaag
atcgccggattcctgctcgacttttatgacaacgaggtcaagcagggacgcatccccaag
aacctgctgccgctccagtccggcgtcggcaacatcccgaacgccgttcttgacggcctg
cttcactccgacctggagcatctgacctcgtacaccgaggtgatccaggacggcatgatc
gacctcatcgacgccggcaagcttgacgtcgcctccgctaccgccttctcgctgtcgcct
gactatgcgcacaagatgaacgagaatgcagccttctaccgcgatcacatcattttgcgc
ccgcaggaaatttcgaaccaccccgaggtcattcgccgcctcggcgtcatcggcgctaac
ggcatgatcgaggccgacatctatggcaatgtcaactcgacccatgtcatgggctcgcgg
atgatgaacggcatcggtggatccggcgacttcacccgcaatgcctacatttcggccttc
gtgtccccatcgacagccaagggtggcgccatctcggcgatcgtcccgatggtctcccac
gtcgaccacaccgagcacgacggcatggttatcatcaccgagcaaggcatcgctgatctg
cgtggcctggccccacgccagcgcgccccgaagatcatcgagaactgtgcccacccggac
taccgtccgatgctgctcgactactacgagcgtgcgctgcgcgactgcaagttcaagcac
accccgcacctgctgggtgaggcgtactcatggcacacccggttcctcgagaccggcacc
atgaagaaggactga

DBGET integrated database retrieval system