KEGG   Cutibacterium acnes 266: PAZ_c21660Help
Entry
PAZ_c21660        CDS       T01971                                 

Gene name
hemY2
Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
paw  Cutibacterium acnes 266
Pathway
paw00860  Porphyrin and chlorophyll metabolism
paw01100  Metabolic pathways
paw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:paw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PAZ_c21660 (hemY2)
Enzymes [BR:paw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     PAZ_c21660 (hemY2)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     PAZ_c21660 (hemY2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_2 Pyr_redox_2 FAD_binding_3 Shikimate_DH HI0933_like Pyr_redox_3 Pyr_redox Thi4 FMO-like FAD_oxidored GIDA
Motif
Other DBs
NCBI-ProteinID: AEE73289
Position
2204506..2205918
Genome map
AA seq 470 aa AA seqDB search
MVPERAYPQTVSKTVAVIGAGMTGLAAAHHLHSHGCRPVVLEAGQGVGGQVRSRRLGSDV
VDMGPEAVPLRAPGVAALVAELGLTDSMRHPVPGRVLLSSRRGVVEMPSGVTPVGPTKFL
PTIASRILSPAGLLRAGLEPFNAHPHLDDVSVGQFIAERFGDEVSRAVVDPLLGGIHAAD
LNTFSLAVAAPALEQTVRNGDSIVAGTLKRNAAGRWSQLRHHSQRSGPRTPATATWKHGL
MMLPEALARELTIHTNTRARGIRQVGHEWVVDVTGPHGVGSVAVDDVIIATPARVAGALL
ATACPRASELLSQCESTTVATLVMQADLTDHPIATAQTWFIGSAWSALVRQVTNLSTTWH
LAKPTFRIAMGRQRGTPIDDLSDDDLVAMSVAELRRLGLALDPHDYVIERHRGAMPQPAP
GHRERMAQLAATLNGTGLHVGGAGIDGAGVGTAIAAGRRLARHITSKEEN
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
ttggtgccagaacgtgcgtaccctcaaacggtgagcaaaacagtggcagtcatcggtgcc
ggaatgacgggcctggcagccgcacaccacctacacagccacggctgtcgtcccgtcgtc
ctcgaagcggggcagggcgttggcggccaggtcaggtcccgtcgtcttggttctgatgtg
gtcgacatgggacctgaagccgtgcctcttcgcgccccgggcgtcgccgcactcgttgcg
gagctgggactaacggactccatgcgtcatcccgttcctgggcgcgtcttattgtcgagc
cggcgtggagtcgtcgagatgccgtccggcgtaacaccagtagggcccacgaagttcctc
cccactattgcctcgcgcatcctctcccctgccggactgttacgggccgggctcgaacct
ttcaacgctcacccgcaccttgacgacgtcagcgtcggccaattcatcgccgaaagattt
ggtgacgaggtgagccgcgccgtcgtcgacccgctactggggggtattcacgccgccgac
ctcaacacgttctcgctagcagttgccgcccccgctttggagcagacggtcaggaacggc
gactccatcgtcgccggaactctcaaacgcaatgctgccggacggtggtcgcagctccgc
catcattcacagcgatccggtccgcgcacccccgccaccgccacctggaaacacggcctg
atgatgttgccggaagcattggctagggagctcaccattcatacgaatacccgtgccagg
ggaatccgtcaggtcggccacgaatgggtagtcgatgtcactggtccgcatggcgttgga
tcggttgctgttgatgacgtcatcattgccacccccgccagggttgcgggtgccctgctt
gctaccgcatgcccgcgagcttccgagctgctgtcgcagtgtgaaagcactaccgttgcc
acgctggttatgcaggctgaccttactgaccacccgatcgctacggcccaaacgtggttc
attggttcggcatggtctgccctggtgcgtcaggtgaccaatctctcgacgacgtggcac
ctcgccaaacccacctttcggatcgccatgggtcggcagcgtggaacccccatcgacgat
ctatctgacgacgacctcgtcgccatgagcgtggcagagttgagacgtctcggactggct
cttgacccccacgactacgtcattgagcgacaccgcggcgccatgccgcaaccagctcct
ggccaccgggagcgcatggcccagctcgccgcgaccctcaacggcaccggtctccatgtg
ggaggggccggtatcgacggtgccggagttggcaccgcaattgctgctggacgccgtctc
gcacgccacatcacctcgaaggaggagaattag

DBGET integrated database retrieval system