KEGG   Cutibacterium acnes 266: PAZ_c23780
Entry
PAZ_c23780        CDS       T01971                                 

Definition
(GenBank) D-ornithine aminomutase E component
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
paw  Cutibacterium acnes 266
Pathway
paw00472  D-Arginine and D-ornithine metabolism
paw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    PAZ_c23780
Enzymes [BR:paw01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     PAZ_c23780
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: AEE73487
Position
2405514..2407832
AA seq 772 aa
MTIQDTCLHHKHTREREQLGPNNKSAVTPSEPVEPRTEQDLPGPNTKLNVEEILTDLEHY
HPRRKGWTWRNVPEEGIDMGDFHYRNMSTPLKQSMPLPAAEYFENIDPQPAPVVTSEIAS
GHFEDDLRRMRMAAWHGADHIMVIRTTGQSHIDGLLEGTPEGIGGVPITRKQLRASRKAC
DLIEDEVGRPINFHSYVSGVAGPEVAVLFAEEGVNGAHQDPQYNLLYRNINAYRSYVDAG
EAKKAMAGAQIFQIDGAHNANATARHGWKVMPELMVQHGLNCMYSVLVGMPKDLIGLSTV
PPSAPPAPKLWYDLPYAVALRDLFSEYKMRAQQNTRYIESDLAEAIRTHTIDTLISMLTS
ADIQSTITPDEGRNLPWHHNSVRGVQTVKQTWTALDGIKEMVTINREGPLGHMVRDLKER
AIGFLTEMLHVGGYFVAVEDGFFVDSAEFPERNHDGIARDGQGGIAEGTVVERDPDYLAP
VCDHFGNNNLPEGLNKPCDLIDGCTLCKPEKIIYIDELDPNDSAATRLACTRPFRDGTAL
RPEAEWAGDGVVLVQMNIPGSEDIAREAAVEMARKMGITDPQVCNLQVLHPAEGCFVEVK
GQATHVDVNPSKLTIPEKIELLPADELRQFVTDHELSVVAGTVGEDEHSVGLREILDIKH
GGIEKYGVKYRYLGTSVPVEKMVDAAIESGADAILISTIISHNDIHRTMMRKLADLATEK
GIRDKVVLVAGGTQVNREMAAETGLDATFGRGTKGIDVLDAIVRTMRTRAEA
NT seq 2319 nt   +upstreamnt  +downstreamnt
atgactatccaagacacgtgcctgcaccacaagcacacccgcgaacgcgagcagctcggc
ccgaataacaagtccgccgtgacgccttcagagcccgtcgagccccgcaccgagcaggac
ctcccaggcccgaataccaaactcaatgtcgaggagatcctcaccgaccttgagcactac
cacccccgtcgcaagggatggacctggcggaacgtgccggaagagggaatcgacatgggc
gacttccactaccggaacatgtccaccccgttgaagcagagcatgcctctgcccgccgca
gagtacttcgagaacattgatccccagccggcacccgtcgtcacctccgagatcgcctcc
gggcacttcgaggacgacctgcgccgtatgaggatggcggcctggcacggagctgaccac
atcatggtcatccgcaccaccggacagagccacatcgacggactactagagggcaccccg
gaaggtatcggcggcgttccgatcacccgtaaacagctgcgcgctagccgcaaggcctgc
gacctcatcgaggacgaggtagggcgccccatcaacttccactcctacgtgtccggagtc
gccggccctgaggtggccgtcctcttcgccgaagagggggttaacggtgctcatcaagac
ccgcaatacaacctgctgtaccgcaacatcaacgcctaccgcagctatgttgacgccggt
gaagccaagaaggcgatggcgggagctcagatcttccaaatcgacggtgcacacaacgcc
aacgccactgcccggcacggttggaaggtcatgcccgagctcatggtccagcacggcctc
aactgcatgtactcagtgctggtaggaatgccgaaggacctcatcggcctgtcgacggtt
ccgcccagcgctcccccggcgccgaaactctggtacgacctgccgtacgcagtagccctg
cgcgatctgttcagcgagtacaaaatgcgcgcccagcagaacacccggtacatcgagtcc
gacctcgccgaggccatccgcacccacaccatcgacactctcatctcaatgctgaccagc
gcggacatccagagcaccatcacccctgatgaaggccgcaacctgccctggcaccacaac
tctgtccgcggcgtccagacggtcaaacagacctggaccgctctcgatggcatcaaggag
atggtgaccatcaaccgcgaggggccactcggccacatggtgcgtgacctcaaggagcgg
gcgatcggtttcctcaccgagatgctgcacgtgggtggctacttcgtcgccgttgaggac
ggattcttcgtcgactcggcagaattcccggaacgcaaccacgacggcatcgcccgtgac
ggccaaggcggaatcgccgagggaaccgtcgtcgagcgtgaccccgactacctcgcccca
gtctgcgaccatttcggcaacaacaacctgcccgagggccttaacaagccgtgcgacctc
atcgacggctgcaccttgtgcaaacccgagaaaatcatctacatcgatgagctcgacccc
aacgactcggccgcgacccgcctggcctgcacccgcccgttccgcgacggcacagcgcta
cggcccgaggctgaatgggccggtgacggtgtcgtcctggtacagatgaacatccccggc
tccgaggacatcgcccgcgaggcggccgtcgagatggcacgcaagatgggcatcaccgac
ccacaggtatgcaacctgcaagtgctgcaccccgccgaaggatgcttcgttgaggtcaaa
ggccaggcgacccacgtcgacgtcaacccatccaagctgacgatccccgagaagatcgaa
ctgctacccgccgacgaactacgccaattcgtcaccgaccacgagttgtcggtggtggcc
ggcactgtcggtgaggacgagcacagcgtcgggctgcgcgagatcctcgacatcaagcac
ggtggcatcgagaagtacggggtgaaatatcgctaccttggcacatcggtgccggtggaa
aagatggtcgatgccgctatcgagagtggcgccgacgccatcctcatctccacgatcatc
agtcacaacgacatccatcgcaccatgatgcggaagttggctgatctggccaccgagaag
ggcatccgcgacaaggtcgttctcgtcgccggcggcacccaggtgaaccgggagatggca
gcagagaccggcttggacgccaccttcgggcgcggcaccaagggcatcgacgtccttgac
gccatcgtgcgcactatgcggacccgcgcggaagcctga

DBGET integrated database retrieval system