KEGG   Cutibacterium acnes TypeIA2 P.acn31: TIA2EST36_01515Help
Entry
TIA2EST36_01515   CDS       T01655                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pax  Cutibacterium acnes TypeIA2 P.acn31
Pathway
pax00860  Porphyrin and chlorophyll metabolism
pax01100  Metabolic pathways
pax01110  Biosynthesis of secondary metabolites
pax01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pax00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TIA2EST36_01515
Enzymes [BR:pax01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     TIA2EST36_01515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AEW82904
Position
complement(348520..349245)
Genome map
AA seq 241 aa AA seqDB search
MTTNPADLVKPPVVVPRDDSHDKFVTTLKQAGYGVIHTALTRTVTLPDAERLTAPDLWQA
DWLVVTSKTTVGLLPTPLPNPNIKVAAVGAATSAALRTRGIDVDFVPENHSGAGLVAEWP
GGVASILLPASQLTADTVPLGLTKVGCTVNRLEIYTTAAVEKLPEVIAQSWPSVGVVVVT
ASSVGRALVELVEPLGWRRQKLVALGKPTARTLEVLGHPAHAVASSPTPEAVLEAVESLV
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaccacaaatcctgccgatctcgtcaagcccccagttgttgttccccgtgacgactcc
cacgacaaattcgtgacgactttgaagcaggccggttatggagtgatccacacagcgctg
acgcgcaccgtcaccttgccggatgcggagaggcttactgcccctgacctgtggcaggcc
gactggctggtcgtcacctcgaagaccaccgtcggactgctccctaccccgttgccgaat
cccaacatcaaagtagctgcggtcggcgccgctacctctgctgcgctgcgcacacgtggg
attgacgtcgacttcgtccccgagaatcacagcggcgctggtctggtcgccgagtggcca
ggtggagtcgccagtatcctcctaccagcgtcccagttaaccgccgataccgtaccgctg
gggctgacgaaggtcggctgcacggtaaaccgattggagatctataccaccgctgccgtc
gagaaactgcctgaggtcatcgcccagtcgtggccgtctgtcggggtcgtcgtcgtcact
gcctcctcggtgggacgtgccctcgtcgagctggtagagccgctgggatggcgtcgtcag
aagctcgtcgccctcggtaagcccactgcaagaacactcgaagtactcggtcacccagcg
catgcggtggcctcctcccccactcctgaagccgtccttgaggcggttgagtccttggtc
gcctga

DBGET integrated database retrieval system