KEGG   Cutibacterium acnes TypeIA2 P.acn31: TIA2EST36_03470Help
Entry
TIA2EST36_03470   CDS       T01655                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pax  Cutibacterium acnes TypeIA2 P.acn31
Pathway
pax00020  Citrate cycle (TCA cycle)
pax00310  Lysine degradation
pax01100  Metabolic pathways
pax01110  Biosynthesis of secondary metabolites
pax01120  Microbial metabolism in diverse environments
pax01130  Biosynthesis of antibiotics
pax01200  Carbon metabolism
Module
pax_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pax_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pax00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TIA2EST36_03470
  Amino acid metabolism
   00310 Lysine degradation
    TIA2EST36_03470
Enzymes [BR:pax01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     TIA2EST36_03470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: AEW83289
Position
complement(756373..758106)
Genome map
AA seq 577 aa AA seqDB search
MSTEVTLPALGESVTEGTVSRWLKAVGDTVEADEPLLEVSTDKVDTEVPSPASGTLLEIK
VPEDEDAEVGAVLAIIGDPSESGSAPAEAPSGNNEAAEPQPEPEPAAERKPAPSGGSAQG
VEVTLPALGESVTEGTVSRWLKAVGDTVEADEPLLEVSTDKVDTEVPSPASGTLLEIKVP
EDEDAEVGAVLAIIGDPSAVESAPAPAKPTAEPAEKAKPEPVKSEAEEAPAPTAPKPAEA
PKPAGTNEVAPRATNPSSDVYVTPLVRKLARENNVDLSTITGTGVGGRIRKQDVLAAAGK
SGEAPSAPQAPAAAPAPAAPKPAGSARKASQEVSPEAAALRGTTEKMSRLRKVIASRMVE
SLQISAQLTATVEVDMTAISRIRNAEKAAFKAREGVGLSYLPFITKAVVEALKANPTFNA
NIDTEAGTITYGSSENIGIAVDTPRGLLVPVIKNAGDLNIAGLTHQIGDLAARTRDNKVT
PDELSGGTFTITNYGSAGALFDTPIVNQPEVAILGTGALVKRPVVVTNEFGEDTIAVRDM
MYLSLSYDHRLIDGAVAARFLSGIKARLEEGDFAGEF
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccgaagtcactcttcctgcactgggcgagtccgtcaccgaaggcaccgtgtcc
cgctggctcaaggctgtcggagacaccgtcgaggccgacgaacccttacttgaggtgtcc
accgacaaggtcgataccgaagtcccctcccccgcctccggcaccctacttgagatcaag
gtccccgaagacgaagacgccgaagtcggcgccgtcctagccatcatcggcgacccctcc
gagtcgggctctgcgcctgctgaggcccccagtggcaataatgaagctgccgaaccgcag
cccgaacctgagccggctgccgagcggaagccggctccttccggtggttccgctcaggga
gttgaggtcaccctgccggctctgggcgagtccgtcaccgaaggcaccgtgtcccgctgg
ctcaaggctgtcggagacaccgtcgaggccgacgaacccttacttgaggtgtccaccgac
aaggtcgataccgaagtcccctcccccgcctccggcaccctacttgagatcaaggtcccc
gaagacgaagacgccgaggtcggcgccgtcctagccatcatcggcgacccctctgctgtc
gagtcggcccctgcgcctgctaagccgacggctgagcccgcggagaaggccaaacctgag
ccggtgaagagcgaggccgaggaggcaccggcgccgaccgcgccgaagcccgccgaggct
cccaaacccgccgggaccaatgaggtcgccccacgcgccaccaacccgtcgtcggacgtc
tacgtcaccccgctagtccgcaagctcgcccgggagaacaacgtcgacctgtcgacgatc
accggaactggtgtcgggggtcgtattcgcaagcaagacgtactagctgcagccggtaag
tctggagaagctccctcagctcctcaggcaccggctgccgcccctgccccggctgctccg
aaaccggctggttcagcccgtaaagcctcccaggaagtctctccggaagctgccgctctg
cgcggcaccaccgagaagatgagccgtctacgcaaggtcatcgcctcgcggatggttgag
tccctgcagatctcggctcagttgacggccaccgtcgaggtggacatgaccgctatctcc
cgcatccgcaacgctgagaaggctgctttcaaggcccgcgagggagtcggtctgtcctac
ttgcctttcattaccaaggccgtcgttgaagccctcaaggccaatccgaccttcaacgca
aatatcgacaccgaggcggggacgattacctacggttcttctgagaacatcggcatcgcc
gttgataccccgcgcgggctgctggttccggtcatcaagaacgctggtgatctcaatatc
gctgggctgacccaccagattggcgatctcgctgcccgcacccgcgacaacaaggtgacc
cctgacgagctgtccggcggcaccttcaccatcaccaactatggctcggctggagccctc
ttcgacaccccgatcgtcaaccagcccgaggtcgccatcctcggcaccggtgctctggtt
aagcgcccagtcgtcgtcaccaacgagttcggcgaggataccatcgcagtccgcgacatg
atgtacctctcgctgtcctacgatcaccggctcattgacggcgctgtggcggctcgcttc
ctatcgggcatcaaggctcgtctggaggagggcgacttcgccggagagttctga

DBGET integrated database retrieval system