KEGG   Cutibacterium acnes TypeIA2 P.acn31: TIA2EST36_11150
Entry
TIA2EST36_11150   CDS       T01655                                 

Definition
(GenBank) hypothetical protein
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
pax  Cutibacterium acnes TypeIA2 P.acn31
Pathway
pax00472  D-Arginine and D-ornithine metabolism
pax01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pax00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    TIA2EST36_11150
Enzymes [BR:pax01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     TIA2EST36_11150
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A
Other DBs
NCBI-ProteinID: AEW84786
Position
2409284..2409706
AA seq 140 aa
MSNPDQERVERYEALRTELADLDDAALKERFWQLCEEVMTPVVDLARTHTTPSIERSVLL
RMGIDSVTTHAVVENVFAAGLGGKGAGHAVLRLSRRDGIGLRDAATRIAEDPKALDELFD
GSPLPPAKTPTTDSKEGASA
NT seq 423 nt   +upstreamnt  +downstreamnt
atgtccaacccggatcaggagcgcgtcgaacgctacgaagctctgcgcaccgaactcgcc
gatctcgacgacgccgccctcaaggaacgcttctggcaattgtgcgaagaggttatgacc
ccggtcgttgacctcgcccgcacccacaccaccccgtccattgaacggtccgtcctactg
cgcatgggcatcgactcggtgacaacccacgccgtcgtggagaacgtgttcgcagcaggc
ctgggtggcaaaggggctggccacgccgtgctgcgactatcacgtcgtgacggcattggt
ctgcgtgacgcagctacccgcatagccgaggaccccaaggccctcgacgaactattcgac
ggcagcccgctgccacctgcaaagacaccgaccacggattccaaggaaggagcctcggca
tga

DBGET integrated database retrieval system