KEGG   Photorhabdus asymbiotica: PAU_00179Help
Entry
PAU_00179         CDS       T00941                                 

Gene name
glnA
Definition
(GenBank) glutamine synthetase (glutamate--ammonia ligase)
  KO
K01915  glutamine synthetase [EC:6.3.1.2]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay00220  Arginine biosynthesis
pay00250  Alanine, aspartate and glutamate metabolism
pay00630  Glyoxylate and dicarboxylate metabolism
pay00910  Nitrogen metabolism
pay01100  Metabolic pathways
pay01120  Microbial metabolism in diverse environments
pay01230  Biosynthesis of amino acids
pay02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pay00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PAU_00179 (glnA)
  09102 Energy metabolism
   00910 Nitrogen metabolism
    PAU_00179 (glnA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PAU_00179 (glnA)
   00220 Arginine biosynthesis
    PAU_00179 (glnA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PAU_00179 (glnA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pay04147]
    PAU_00179 (glnA)
Enzymes [BR:pay01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamine synthetase
     PAU_00179 (glnA)
Exosome [BR:pay04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PAU_00179 (glnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gln-synt_C Gln-synt_N
Motif
Other DBs
NCBI-ProteinID: CAQ82272
UniProt: B6VM09
Position
complement(192160..193569)
Genome map
AA seq 469 aa AA seqDB search
MSAEHVLTMIEEHQVKFIDLRFTDTKGKEQHMTIPAHQVNADFFEDGKMFDGSSIGGWKG
INESDMVLMPDPSTAMLDPFFDDATLILRCDILEPGTMQGYDRDPRSISKRAEDFLRSSG
IADTVLCGPEPEFFLFDDVRFGSSMSGSYYHIDDIEAAWNSGTRYEGGNKGHRPAVKGGY
APMPPVDSSQDLRSAMCLTMEEMGLVVEAHHHEVGTAGQNEIATRFNTMTKKADETQIYK
YVVHNVAHNFGKTATFMPKPLVGDNGSGMHCHMSLSKNGTNLFAGDKYGGLSELALFYIG
GIIKHARALNAFTNPTTNSYKRLVPGYEAPVMLAYSARNRSASIRIPVVASTKARRIEIR
FPDPAANPYLAFAAQLMAGLDGIINKIHPGDAMDKNLYDLPPEEAKEIPTVASSLDEALA
ALDTDREFLTRGGVFTDDAIDAYIELKNSEMERVRLTPHPLEFELYYSV
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctgaacatgttttaaccatgattgaagagcatcaggtgaagtttattgatttg
cgtttcactgataccaaaggcaaagaacaacatatgaccattcctgctcatcaggttaat
gcggacttcttcgaagatggcaaaatgttcgatggttcctcaattggcgggtggaaaggc
attaacgaatcggacatggtgctgatgccagatccaagtacagccatgcttgatccattc
tttgatgatgccacgctgatcctgcgttgcgacatcctggaaccaggcaccatgcaaggc
tatgaccgtgaccctcgttccatatccaaacgtgctgaagatttcctgcgttcaagcgga
attgcagataccgtcctgtgtggaccggaacctgaatttttcctgtttgatgacgtgcgc
tttggcagttctatgtccggttcttattatcatattgacgatatcgaagccgcttggaac
tctgggactcgatacgaaggtggtaacaaaggccatcgacccgcggtaaaaggtggttat
gccccaatgcctcccgttgattcttcccaggatttacgttctgctatgtgcctgacaatg
gaagaaatgggactggtcgtagaagctcaccatcatgaagttggcacagctggtcaaaat
gaaatcgcgacccgcttcaacaccatgaccaagaaagctgacgaaactcagatttacaaa
tacgtcgtgcataatgtggcgcacaattttggcaagactgccacctttatgccaaagccg
ctggttggcgataatggctccggtatgcattgccatatgtccctatccaaaaatggcact
aacctgtttgctggggacaaatacggtggcctatccgaactggcgctgttctacatcggc
ggtattatcaaacatgcccgtgccctaaacgcgtttaccaacccgacaaccaactcttat
aaacgtctggttccgggctatgaagcacccgttatgctggcctactctgcccgtaaccgt
tctgcatctatccgtattccggttgtggcaagcaccaaggctcgccgaattgaaatacgc
ttcccggacccagcagctaacccttatctggcttttgctgctcagttgatggctggtctt
gatggtattatcaacaaaatccatccgggtgatgcaatggataaaaacttatatgaccta
ccaccggaagaagccaaagagattccaactgtcgcttcttctctggatgaagcattggca
gccctggataccgaccgcgagttcttgacccgtggtggtgtattcaccgacgacgccatt
gatgcttatattgaattgaaaaacagtgaaatggaacgtgtccgtctgacaccacatcca
ctggagtttgaactgtattacagtgtgtaa

DBGET integrated database retrieval system