KEGG   Photorhabdus asymbiotica: PAU_00282Help
Entry
PAU_00282         CDS       T00941                                 

Definition
(GenBank) putative membrane protein
  KO
K11906  type VI secretion system protein VasD
Organism
pay  Photorhabdus asymbiotica
Pathway
pay03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pay00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PAU_00282
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pay02044]
    PAU_00282
Secretion system [BR:pay02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAU_00282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS-SciN LPAM_1
Motif
Other DBs
NCBI-ProteinID: CAQ82375
UniProt: B6VM82
Position
complement(313385..313939)
Genome map
AA seq 184 aa AA seqDB search
MKRSGNTSWSGIWLVLLAALVLSGCSGAWQATKKVGQVVWDPSTPVGQPADLPSTAAITL
LAEPDINPNKNGEATPVEIHLIYLSEDSRLLAADYDQLKSDELDKALGKNYIDHQDYTLL
PGQYKPLPVIPLEKKSRYIGVIVRYADINQSEWKKVIRVKDTGQQYNILVHIRANEVELR
KEEQ
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgctccggtaatacctcatggtctggcatatggcttgtattgctggcagcgctc
gtgttaagcggttgcagcggtgcatggcaggcaacgaagaaagtcggacaggttgtctgg
gacccatcaactcctgtcggtcaaccggcggatttaccttccactgctgcgatcactttg
ctggcagagcctgacatcaaccccaataaaaatggagaagccactccggttgaaatacac
ctgatttatctcagtgaagattcccgtctgcttgccgccgattatgaccagcttaaaagt
gacgaattagataaagcgctggggaaaaattacatcgaccatcaggattacaccttattg
ccggggcaatacaaaccactacccgtcatcccgctggaaaaaaagagccgttacatcggc
gtcatcgttcgttatgccgatatcaatcaatctgaatggaaaaaagtcatccgagtgaaa
gacacggggcagcaatacaacattctggtgcacatcagagcgaacgaagttgaacttaga
aaagaggaacaataa

DBGET integrated database retrieval system