KEGG   Photorhabdus asymbiotica: PAU_00283
Entry
PAU_00283         CDS       T00941                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11894  type VI secretion system protein ImpI
Organism
pay  Photorhabdus asymbiotica
Brite
KEGG Orthology (KO) [BR:pay00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pay02044]
    PAU_00283
Secretion system [BR:pay02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   PAU_00283
SSDB
Motif
Pfam: FHA
Other DBs
NCBI-ProteinID: CAQ82376
UniProt: B6VM83
Position
complement(313939..315225)
AA seq 428 aa
MEKQQPTLSLRVLNSDQLESGKSASCLFSIQGGTVGSSESHLWSVQDQQGNINPSQFTIQ
WRDGAFCLHMIAGPLFVNKSPLTPGAGLIRLQQADEITIGKLVIKSHISFSDADRTDPMM
VSPESLVSSYSNPLDAMMEKSPVQDSAFTEHHSPAPTINHDFSHDPLKVLDSETLTTQNQ
TSVTNEVDQSLQQGHYRTPLFFSPLSDNRGNAMDRDFVDLPSISSPLSEQYQDMEQQHVA
ITPLMRGLNTQLPLHNSQQANDFLEEMGKTMKAAIEGLLALQRTQHGLRDKQLRPIEDNP
LRLNMDYNTTMQVMFADQKSPVHLSAPSAVAESLQNLQLHYQANRIAITAALNTMLDAFS
PEHLLSRFAQYRRSNETQEKDSTWAWEMYTSYYRELASSRQQGFEKLFSEVYEQAYDRAL
RQGLEDSQ
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggaaaaacaacaaccaaccctttcattaagagtgctcaacagcgatcaactggaaagc
ggtaaatctgccagttgcttgttctccattcaaggtggcacagtcggtagtagcgaaagc
catctctggtccgttcaggatcaacagggcaatatcaatccgtcacaatttactattcag
tggcgtgatggtgcattctgcctgcacatgatcgccggccccctatttgtgaataaatca
ccactaactccgggggccggcctgatccgactgcaacaagcggatgaaattaccatcggt
aagctagtgatcaaaagccatatcagtttttccgacgcagatcggactgatccaatgatg
gtatcaccggaatcattggtctccagctatagcaatccactggacgccatgatggaaaaa
tcacccgttcaggatagcgctttcacagaacatcattctccggcaccaacaataaaccat
gatttcagtcacgacccactgaaggtcctcgacagcgaaacactaaccacacagaaccaa
acatcagtaactaacgaggtagaccaaagcctgcaacaaggccattaccgcacaccatta
tttttctctcccctctcagataacagaggcaatgctatggatcgggattttgttgattta
ccgagtatctcttcacctttaagtgaacaatatcaagatatggaacaacagcacgttgct
atcacaccactgatgcgagggctaaacacacaattacctttgcataatagccagcaagcc
aacgacttcctggaagaaatgggtaaaaccatgaaagcagcaattgaaggtttactggca
ttacagcgtacacagcatggtctgcgtgataaacaactgcgccctatcgaagataatccg
ctacggctaaatatggattacaacaccaccatgcaagtgatgttcgctgatcagaaaagc
ccggtacatctttcagcgccatcagccgtcgctgaaagcttacagaacctgcaattacac
tatcaggctaaccggattgcgattactgccgcattgaacactatgctggatgctttctca
ccagagcacctacttagccgttttgcccagtaccgccgcagtaatgagacccaggaaaaa
gattccacctgggcatgggaaatgtacaccagttactaccgtgaattggcttccagccgt
caacagggattcgaaaagctgtttagtgaagtttacgaacaagcttatgaccgcgctcta
cgccaaggtttagaggatagccagtaa

DBGET integrated database retrieval system