KEGG   Photorhabdus asymbiotica: PAU_00284
Entry
PAU_00284         CDS       T00941                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
pay  Photorhabdus asymbiotica
Brite
KEGG Orthology (KO) [BR:pay00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pay02044]
    PAU_00284
Secretion system [BR:pay02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAU_00284
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: CAQ82377
UniProt: B6VM84
Position
complement(315232..>316212)
AA seq 326 aa
LSKYNFYQLVELLNQLAVAWEKTGQTNRPDRESILFKSSASLAFPTRDVVSVKRTEQGRF
QVEVSFLGLHGSQSPMPGYYLDSLAWEEAQDENRLTNFLNIFNHRSIVMLHQIWRKYRYY
ICFDKNGMDDFSQRMFALVGLGSDVNRSHLQINHSKMLAYAGLLASPGRSPEVISSLVSH
CFDLSDVTVHGWQIRKTTIETSQQNRLGGLLKIRGQKKGIEQSVLGRNFFLGSWVKGCNG
KFLLCINNLSREHFLSFLPDGKNFLPLVMFICFVLRDQLAWDLRLGLAENQADGMVLGTK
QNNSLGWTSFLGKPEKKPFITISVGR
NT seq 981 nt   +upstreamnt  +downstreamnt
ttatcaaaatataacttttaccagttggtcgagttactcaaccaattggcggtagcgtgg
gaaaaaacagggcagaccaatcgccctgaccgagaatcaatcctcttcaaatccagtgca
agcttagcttttccaaccagagatgttgtctctgtgaaacgtaccgagcaaggtcgtttt
caggtagaggtctcctttcttgggctacatggcagccagtcgcctatgcctggttattac
cttgattcgttggcatgggaagaggctcaagacgaaaatcggctgactaattttctgaat
attttcaatcatcgctcaatcgtcatgcttcatcagatctggcggaaatatcgctattac
atctgttttgacaaaaacggaatggatgatttttctcaacgcatgttcgctttagtcgga
cttggcagcgatgtgaaccgctctcatctgcaaatcaatcacagcaaaatgctggcctac
gcaggtctgttagccagccctggccgatcgccggaagtgatatccagtctggtttcacat
tgctttgatctatcggatgtcacggtacatggctggcaaattagaaaaaccaccatcgag
acatcacagcaaaaccgcctgggtggactattgaaaataaggggccagaaaaaagggatt
gaacaatccgtactgggcagaaacttctttctcggttcttgggtgaaaggttgcaacggt
aagtttctgctatgcatcaataatctctcccgagaacacttcctgtcatttctcccggac
ggcaaaaatttcctaccactagtgatgtttatttgttttgtcctgcgtgatcaattggcc
tgggatctacgtcttggactagccgaaaaccaggcagatggcatggtacttggcacgaaa
caaaacaacagcttggggtggaccagctttctcggcaaaccagagaagaaaccctttatc
actatttcagttggcagataa

DBGET integrated database retrieval system