KEGG   Photorhabdus asymbiotica: PAU_00286
Entry
PAU_00286         CDS       T00941                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11905  type VI secretion system protein
Organism
pay  Photorhabdus asymbiotica
Brite
KEGG Orthology (KO) [BR:pay00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pay02044]
    PAU_00286
Secretion system [BR:pay02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAU_00286
SSDB
Motif
Pfam: GPW_gp25 RHD3
Other DBs
NCBI-ProteinID: CAQ82379
UniProt: B6VM86
Position
complement(318080..318520)
AA seq 146 aa
MAALYSWNREGSASLFERIQGKNSGSSRQSRMRELLNSVKRHLNNILNTHPGACQSAVDL
GVIDLNDATTTATDFKQSIEQAIEHCIRNYEPRISSVSVSAIHDDSDPLLLSFHISAQVS
LDDIHDVVEFNIQLDNNRRYCLERTQ
NT seq 441 nt   +upstreamnt  +downstreamnt
atggctgcgctgtacagttggaatagagagggctctgccagcttgtttgagcgtattcag
gggaagaactccggttcttcccgccagtccagaatgcgtgagctacttaactccgtaaaa
cggcacctgaataatattctcaatacccatccaggtgcttgccagagcgcggttgatctc
ggcgttattgatctcaatgatgccacaaccactgcgactgactttaaacagagtattgaa
caggcaatagagcactgcatcagaaattatgaaccaagaatatcgtcagtctctgtcagc
gcaatccatgatgacagtgacccactgctgttaagttttcacatcagtgcccaggtatcc
ctggatgatattcatgacgttgttgaatttaacattcaactggataacaaccggcgttat
tgcctagagcggactcaataa

DBGET integrated database retrieval system