KEGG   Photorhabdus asymbiotica: PAU_00535Help
Entry
PAU_00535         CDS       T00941                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay00260  Glycine, serine and threonine metabolism
pay00750  Vitamin B6 metabolism
pay01100  Metabolic pathways
pay01110  Biosynthesis of secondary metabolites
pay01120  Microbial metabolism in diverse environments
pay01230  Biosynthesis of amino acids
Module
pay_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pay00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PAU_00535 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PAU_00535 (thrC)
Enzymes [BR:pay01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PAU_00535 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: CAQ82627
UniProt: C7BJW1
Position
600743..602035
Genome map
AA seq 430 aa AA seqDB search
MKLYNLKDNSEQVSFAQAVKQGLGKQQGLFFPQDLPEFSREEIDQLLKLDFVTRSGRILS
AFIGDEIPPEQLAARVKSAFTFPAPVAKVAEDIATLELFHGPTLAFKDFGGRFMAQILAQ
VAGEQPVTILTATSGDTGAAVAHAFYGLNNVQVVILYPQGKISPLQEKLFCTLGGNIHTV
AIDGDFDACQSLVKQAFDDQELKQALYLNSANSINISRLLAQICYYFEAVAQVPEDKREK
LVISVPSGNFGDLTAGLLAKSMGLPVKRFIAATNVNDTVPRYLADGKWLPNQTVATLSNA
MDVSQPNNWPRIEELFRCQSWSLSELGYGVVSDEVTKETIKELAKLGYISEPHAAVAYRV
LRDQLQEDEYGLFLGTAHPAKFKESVEQILGEELPLPKALAERADLDLLSHDLPADFVKL
RAFLMERAPK
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtataacttaaaagacaacagcgagcaggtgagttttgcgcaggcagtaaaa
caggggttaggtaaacaacaaggacttttcttcccgcaagatttacccgaattcagtcgt
gaagaaattgaccaactgttgaaactggattttgttacccgcagtggccgcattctttca
gcatttattggcgatgaaattccgccagaacaactagcggcaagggttaagagtgctttt
acttttccagcacctgttgcaaaagtggcagaggatattgcaacgctggaattattccac
ggcccgactctggcattcaaagattttggtggtcgttttatggcacaaatactggcacag
gttgctggtgagcagcctgtgactatcttgactgcgacttccggcgatactggtgccgca
gtagcgcatgccttctatgggttgaacaatgtacaggtggttattctctatccgcagggt
aaaattagcccgttacaggaaaaactgttctgtacattgggcggtaatattcacacggtt
gcgattgatggtgatttcgatgcttgccaatcgttggtcaaacaggcgtttgatgatcag
gaattgaaacaagctctgtatctcaattcagctaactcaattaacattagccgcttattg
gcacaaatttgctattactttgaggcggtggctcaggtaccagaagataagcgcgaaaaa
ttggttatttctgtgcccagtgggaattttggtgatttgaccgcgggtttattagcgaaa
tcaatgggattgccggtaaaacgttttattgcggcgactaatgttaacgacacggttcca
cgttatctggcagatggaaaatggctgcctaatcagacagttgctactctttccaacgcg
atggatgttagccagccaaataactggccgcgtattgaagaactttttcgttgtcaatcc
tggtcattaagtgagttgggatatggcgtagtcagcgatgaggtcactaaagagaccatc
aaggaattggctaaactgggttatatctctgaacctcatgcagcagttgcttaccgcgtc
ttgcgtgatcaattacaggaagatgaatacggattatttctcggtacggctcatccggcg
aaatttaaagagagtgtggaacagattctgggtgaggaattaccattgcctaaagctttg
gcagaacgggctgatttagacttgttatcccatgatttgccggcagattttgttaaatta
cgtgctttcttgatggaaagagcccctaagtaa

DBGET integrated database retrieval system