KEGG   Photorhabdus asymbiotica: PAU_00592Help
Entry
PAU_00592         CDS       T00941                                 

Gene name
recD
Definition
(GenBank) exodeoxyribonuclease V alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:pay00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PAU_00592 (recD)
Enzymes [BR:pay01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PAU_00592 (recD)
DNA repair and recombination proteins [BR:pay03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     PAU_00592 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Helicase_RecD Viral_helicase1 AAA_11 DUF2075 UvrD-helicase AAA_22 UvrD_C AAA_16 AAA_28 SRP54 AAA_24 MukB T2SSE AAA_14 PhoH CbiA Bcl-2 AAA AAA_33 NACHT NTPase_1 DUF87 AAA_29 ResIII
Motif
Other DBs
NCBI-ProteinID: CAQ82684
UniProt: C7BKJ8
Position
673715..675571
Genome map
AA seq 618 aa AA seqDB search
MISLLQQAVDLRLLRSLDLQFAHALIGDENPALLLVMALLSAEAGAGHVCLPISRIMPEY
FFDGRQREFAEQLWQVAGKPDEQSLRAALESCAAVSDGFQPAPVVLSHNRLYLQRMWQSE
CQVAAFFSTNNQSTDSIQEEQLRTILDELFTLSDETMDWQKVAAAVAVTSRVSVISGGPG
TGKTTTVAKLLAALIKLNPDKNLVIRLAAPTGKAAARLTESLNSAVRKLSLTEKQFESMP
DQAQTIHRLLGAQPDSQQLRYDRDNPLSLDVLVVDEASMVDLPMMARLVDALPLYAKIVL
LGDRDQLASVEAGAVLGDVCRFVEMGYSAVRVEQLSRLTGCQLVAGEQENIPEVRDRLCL
LRRSYRFDVDSGIGQLAAAVNQGKSRQALSILQQPLNDICFYPLLDDEDYQRLLAETVLS
YRSYLQLVAKQAPAKEVLDEFNRYRLLCALREGPFGVSGLNERIEQLLHRQGLIRRPMGI
FSRGYAGRPIMISRNDSILGLFNGDIGIMLRDENSELRAYFQLPDGQIKGIQPSRLPQHE
TAYVMTVHKSQGSEFEHTALVLPTQFVPVVSRELVYTAMTRARKKLTLYTHDAVLRQAIQ
TPTQRRSGLAERLSRLVD
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgatttcgttattacaacaggcagtagatctcaggcttctgcgctcattggatttacag
ttcgctcatgcgttgattggggatgaaaatcctgctctgttgctggtgatggcgctatta
agtgctgaagctggtgctgggcatgtttgcctacctattagccggataatgcctgaatat
ttttttgatgggcggcagcgtgaatttgcagagcagttatggcaggtggcagggaaacct
gatgagcagagcttgcgtgcagcattagagagttgtgctgctgttagtgatggctttcag
ccagcacccgttgttctttcgcataaccgactttatttgcaaaggatgtggcaaagtgag
tgccaagttgctgcttttttctctaccaacaatcaatcaaccgatagtattcaggaagag
cagctgagaactattctggatgaattatttacgctatctgatgagacaatggactggcaa
aaggtggctgctgctgtagcggtaactagcagagtttcagttatctctggtgggccggga
accgggaaaacaacaactgttgcgaagttattggcagctttaatcaaacttaatcctgac
aaaaatctggtgatccgattggctgctccgacgggaaaagcagctgccagattgacagaa
tctcttaacagtgctgtcagaaagctttctctgacggagaaacagtttgaatctatgcca
gatcaggcccagacgattcaccgcttattaggggctcagccggatagtcagcagttacgt
tatgaccgagataacccattgagtttggatgttttggtggtagatgaagcttcaatggtg
gatttgcccatgatggctaggttggttgatgcgttaccgttatatgcaaaaattgttttg
cttggtgatcgtgatcaattggcgtcagtggaggctggagctgtattgggagatgtatgc
cgttttgttgagatgggatatagcgccgtgagagtggagcagctaagccgattgactgga
tgccagttagttgcaggcgagcaggagaatatcccggaagttcgtgatcgtttgtgcctt
ttacgcagaagttatcgttttgatgtagattcggggataggtcaacttgctgcggcagtt
aatcagggaaagagtcggcaagctctctctatcttgcaacagccattgaatgatatctgt
ttttacccattgcttgacgatgaagattatcagcggttactggctgaaacggtattgagt
tatcgctcttatttgcaactggttgcaaagcaagcaccggctaaagaggttttggatgaa
tttaaccgctatcgtttgttgtgtgcacttagagaagggccatttggtgttagtggactt
aatgagcgtatagaacagctattacatcgtcaggggcttattcgtcgccctatggggatt
tttagtcgtgggtatgcaggtcgaccaattatgatttcccgtaatgacagtatacttggc
ctgtttaatggtgatatcggtattatgctcagggatgaaaatagtgaactacgtgcttat
tttcaactaccagatggacagattaaaggaattcaaccaagccgtttaccacagcatgaa
acagcatatgtgatgactgtacataaatcgcagggatcagaatttgaacatacggctctg
gtactgccaacgcagtttgtaccggttgttagccgagaactggtctatacagcgatgact
agggctagaaagaagctaacgctttatacacatgatgcggtattgcgtcaggccattcaa
acgcccactcaaaggcgtagtgggttggctgaacgtcttagccggctggtggattag

DBGET integrated database retrieval system